Recombinant Xanthomonas campestris pv. vesicatoria C4-dicarboxylate transport protein (dctA)

Shipped with Ice Packs
In Stock

Description

Substrate Specificity

DctA transports four C4-dicarboxylates:

SubstrateAffinity (Km)Proton CouplingElectrogenicity
Succinate0.2–5 µMH+ symportYes
Fumarate1–10 µMH+ symportYes
Malate0.5–8 µMH+ symportYes
OxaloacetateNot reportedH+ symportLikely

Key features:

  • pH dependence: Optimal activity at pH 6.0–7.5 .

  • Temperature sensitivity: Activity declines above 40°C .

  • Inhibition: Competitively inhibited by structural analogs (e.g., methylsuccinate) .

Functional Role in Bacterial Physiology

  • Metabolic role: Enables aerobic growth on C4-dicarboxylates as sole carbon sources .

  • Pathogenicity: Indirectly supports virulence in Xanthomonas by enhancing nutrient acquisition during plant infection .

  • Regulation: Transcriptionally controlled by two-component systems (e.g., DctB/DctD) and CRP-cAMP in some species .

Recombinant Expression and Purification

Functional validation:

  • Transport assays confirm proton-dependent uptake of radiolabeled succinate .

  • dctA knockout strains show 90% reduced dicarboxylate uptake .

Research Applications

  • Mechanistic studies: Used to elucidate transport kinetics and proton coupling in DAACS family proteins .

  • Pathogen metabolism: Investigates carbon source utilization during plant colonization .

  • Protein engineering: Serves as a template for optimizing microbial production of succinate-derived bioproducts .

Key Research Findings

  1. Electrogenic transport: Each succinate molecule is cotransported with 3 H+ ions, generating a measurable membrane potential .

  2. Substrate recognition: The divalent anionic form of succinate (S²⁻) is the preferred substrate .

  3. Regulatory mutations: Promoter mutations (e.g., dctA*) enhance transport efficiency under nutrient-limited conditions .

  4. Structural insights: Homology modeling based on Pyrococcus horikoshii GltPh suggests a conserved "hourglass" fold with a solvent-accessible substrate channel .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes 50% glycerol; however, you can adjust this based on your requirements.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us and we will prioritize developing your preferred tag type.
Synonyms
dctA; XCV3599; C4-dicarboxylate transport protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
dctA
Target Protein Sequence
MHISKPAGPLPASVPFYRQLYFQVVVAIVLGALLGHFEPAFAESLKPLGDAFIKLVKMII APVIFLTIVTGIAGMTHLKTVGRVFGKAMAYFLFFSTLALVVGLVVAHVVQPGAGMNINP ADLDQSAVKSYVEKSHDLTLVGFLMDIIPNSLIGAFTGDQVVNGKLTGPNILQVLFVAVL FGVSLALVGERGKPVLNLLEALIAPVFKLVHILMRAAPIGAFGAIAFTIGKYGVESLVNL AWLVGSFYLTSLLFVLVILGLVSRLCGFSVLKLIRYLKAELLLVLGTSSSESALPSLMEK MEKAGCEKSVVGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQIALLAVAMLS SKGAAGVTGAGFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVS RWENALDRDRLKLVLDGGEPPLLAPVGQPGVAPASLR
Uniprot No.

Target Background

Function
This protein is responsible for the transport of dicarboxylates such as succinate, fumarate, and malate across the membrane from the periplasm.
Database Links

KEGG: xcv:XCV3599

STRING: 316273.XCV3599

Protein Families
Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the C4-dicarboxylate transport protein (dctA) in Xanthomonas campestris pv. vesicatoria?

The C4-dicarboxylate transport protein (dctA) in Xanthomonas campestris pv. vesicatoria is a membrane transport protein responsible for the uptake of C4-dicarboxylates such as succinate, fumarate, and malate. These compounds serve as important carbon sources for bacterial metabolism during plant colonization. The dctA protein belongs to the dicarboxylate transport protein family, which is conserved across various bacterial species including different Xanthomonas pathovars. Based on homology with the related X. campestris pv. campestris dctA protein, it is likely a full-length protein of approximately 448 amino acids that functions as an integral membrane protein .

What expression systems are recommended for recombinant production of dctA?

For recombinant expression of dctA from X. campestris pv. vesicatoria, Escherichia coli expression systems have proven effective, similar to those used for the X. campestris pv. campestris protein. The recommended approach involves:

  • Gene cloning with an N-terminal His-tag for purification purposes

  • Expression in E. coli under the control of an inducible promoter

  • Growth conditions optimization (typically 37°C followed by induction at lower temperatures)

  • Cell harvest by centrifugation and protein extraction using appropriate lysis buffers

The recombinant protein can be expressed as a full-length construct (amino acids 1-448 based on the related X. campestris pv. campestris protein) with a His-tag to facilitate purification . For membrane proteins like dctA, specialized E. coli strains designed for membrane protein expression may improve yields and proper folding.

What purification methods are most effective for recombinant dctA protein?

The most effective purification strategy for recombinant His-tagged dctA involves:

  • Cell lysis in appropriate buffer (such as 8 M urea, 0.1 M NaH₂PO₄, 10 mM Tris-HCl, pH 8.0)

  • Collection of soluble protein by centrifugation at 14,000 × g

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Elution with imidazole-containing buffer

  • Buffer exchange to remove imidazole and reduce urea concentration if refolding is required

For membrane proteins like dctA, inclusion of appropriate detergents in the purification buffers is critical to maintain protein solubility and native conformation. After purification, the protein should be stored with 5-50% glycerol (with 50% being optimal) to prevent freeze-thaw damage during long-term storage at -20°C or -80°C .

Purification StepBuffer CompositionConditions
Cell Lysis8 M urea, 0.1 M NaH₂PO₄, 10 mM Tris-HCl (pH 8.0)Room temperature
Protein BindingLysis buffer + Ni-NTA resin1 hour, 4°C with gentle agitation
WashingLysis buffer + 20-40 mM imidazoleMultiple washes to remove non-specific binding
ElutionLysis buffer + 250-500 mM imidazoleCollect 1 mL fractions
StorageTris/PBS-based buffer, 6% Trehalose, pH 8.0 with 50% glycerol-20°C/-80°C

How can protein-protein interactions between dctA and other bacterial proteins be investigated?

Investigating protein-protein interactions involving dctA requires multiple complementary approaches:

  • Bacterial Two-Hybrid System: This can be used to screen for potential interaction partners by fusing dctA to one domain of a split reporter protein and a library of bacterial proteins to the complementary domain. Reconstitution of reporter activity indicates interaction.

  • Co-immunoprecipitation with Tagged Constructs: Express dctA with an affinity tag in X. campestris pv. vesicatoria, isolate protein complexes via the tag, and identify interacting partners by mass spectrometry. Similar methodologies have been successfully applied for other bacterial membrane proteins in Xanthomonas species .

  • Cross-linking Coupled with Mass Spectrometry: This approach can capture transient interactions that might be missed by other methods. In situ cross-linking followed by purification and mass spectrometry analysis can reveal the interaction network of dctA.

  • FRET-based Approaches: Fluorescent protein fusions to dctA and candidate interacting proteins can be used to detect interactions in live bacterial cells, providing spatial and temporal information about these interactions.

When designing these experiments, it's crucial to consider the membrane-embedded nature of dctA, which may require specialized approaches to maintain protein structure and function during the analysis .

What role might dctA play in the virulence of X. campestris pv. vesicatoria?

The dctA protein likely plays an important role in virulence by facilitating carbon acquisition during infection, though its specific contribution has not been directly documented in the available search results. Based on functional studies of related transport systems and virulence factors in Xanthomonas species, several hypotheses can be proposed:

  • Nutrient Acquisition: dctA may enable bacterial growth in planta by efficiently transporting plant-derived C4-dicarboxylates, thus contributing to bacterial fitness during infection.

  • Metabolic Adaptation: The protein might help bacteria adapt to changing nutrient availability in different plant tissues or during different infection stages.

  • Stress Response: dctA could be involved in bacterial adaptation to host-induced stress conditions, similar to how other transport systems function during pathogen-host interactions.

To investigate these hypotheses, researchers could generate dctA deletion mutants in X. campestris pv. vesicatoria using homologous recombination techniques similar to those described for other gene deletions. Standard molecular techniques used for DNA manipulation and verification in Xanthomonas would be applicable, including PCR amplification of flanking regions, cloning into suicide vectors like pOGG2, and selection for double-crossover events .

How can transcriptional regulation of the dctA gene be studied in X. campestris pv. vesicatoria?

Studying the transcriptional regulation of dctA requires several methodological approaches:

  • Promoter Mapping and Analysis:

    • Identify the promoter region upstream of dctA using bioinformatic approaches

    • Clone different lengths of the putative promoter region upstream of a reporter gene (e.g., GFP or luciferase)

    • Transform these constructs into X. campestris pv. vesicatoria to measure promoter activity under different conditions

  • Transcription Factor Identification:

    • Perform DNA affinity chromatography using the dctA promoter region as bait

    • Isolate and identify bound proteins by mass spectrometry

    • Validate potential transcription factors through EMSA (Electrophoretic Mobility Shift Assay) and ChIP (Chromatin Immunoprecipitation) analyses

  • Environmental Regulation Studies:

    • Use qRT-PCR to measure dctA expression changes in response to:

      • Different carbon sources

      • Plant extracts

      • Various stress conditions (pH, temperature, oxidative stress)

      • During different stages of plant infection

  • Genome-wide Approaches:

    • RNA-Seq analysis to identify co-regulated genes

    • ChIP-Seq to map transcription factor binding sites across the genome

For genetic manipulations in these experiments, standard techniques for Xanthomonas would be appropriate, including triparental mating for plasmid mobilization from E. coli into X. campestris pv. vesicatoria strains and the use of broad-host-range vectors similar to those described for other Xanthomonas studies .

What experimental approaches can be used to study dctA's role in bacterial-plant interactions?

Several experimental approaches can elucidate dctA's role in bacterial-plant interactions:

  • Gene Knockout and Complementation Studies:

    • Generate dctA deletion mutants using homologous recombination

    • Complement these mutants with wild-type or mutated versions of dctA

    • Assess the impact on bacterial growth in planta and disease progression

    • These genetic manipulations can follow established protocols for Xanthomonas, using suicide vectors and selection of double-crossover events

  • Infection Assays with Metabolic Manipulation:

    • Compare wild-type and dctA mutant strains in their ability to cause disease on host plants

    • Supplement plants with different C4-dicarboxylates to determine if this affects pathogen virulence

    • Use 13C-labeled dicarboxylates to track their uptake and metabolism

  • Transcriptome and Proteome Analysis:

    • Compare gene expression and protein profiles of wild-type and dctA mutant strains during infection

    • Identify compensatory pathways activated in the absence of dctA

    • Use RNA-Seq and LC-MS/MS approaches for comprehensive analysis

  • In planta Expression Studies:

    • Use reporter gene fusions (GFP, luciferase) to monitor dctA expression during different stages of infection

    • Identify environmental cues that regulate dctA expression in the plant environment

  • Metabolomic Approaches:

    • Analyze changes in bacterial and plant metabolites during infection

    • Compare metabolite profiles between plants infected with wild-type and dctA mutant bacteria

    • Use LC-MS or GC-MS for metabolite identification and quantification

These approaches should be combined with standard virulence assays used for X. campestris pv. vesicatoria, such as bacterial growth curves in planta and quantification of disease symptoms .

How should stability and storage of purified recombinant dctA be optimized?

Optimizing stability and storage of purified recombinant dctA requires careful consideration of buffer composition and storage conditions:

  • Buffer Optimization:

    • Use Tris/PBS-based buffers with pH 8.0

    • Include stabilizing agents such as 6% trehalose

    • Consider adding specific lipids or detergents to mimic the membrane environment

    • Test different buffer compositions systematically to identify optimal conditions

  • Recommended Storage Protocol:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50%

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store at -20°C or preferably -80°C for long-term storage

    • For working stocks, store aliquots at 4°C for up to one week

  • Stability Assessment:

    • Monitor protein stability using size-exclusion chromatography

    • Assess functional activity after various storage periods

    • Use circular dichroism to monitor secondary structure changes over time

  • Lyophilization Considerations:

    • If lyophilization is preferred, include appropriate cryoprotectants

    • Develop a controlled freezing and drying protocol to minimize structural damage

    • Validate that reconstituted protein retains structural integrity and function

What are the most effective approaches for analyzing dctA-substrate interactions?

Analyzing dctA-substrate interactions requires specialized techniques suitable for membrane transport proteins:

  • Transport Assays:

    • Use radioisotope-labeled substrates (14C-labeled dicarboxylates)

    • Measure uptake in whole cells expressing dctA or in reconstituted proteoliposomes

    • Compare uptake kinetics (Km and Vmax) for different substrates to determine specificity

    • Perform competition assays with unlabeled substrates

  • Binding Studies:

    • Isothermal titration calorimetry (ITC) with purified protein in detergent micelles

    • Surface plasmon resonance (SPR) with immobilized protein

    • Microscale thermophoresis (MST) for detecting subtle changes in protein movement upon substrate binding

  • Structural Biology Approaches:

    • X-ray crystallography of dctA in complex with substrates or substrate analogs

    • Cryo-EM studies to visualize different conformational states during transport

    • NMR spectroscopy to map substrate binding sites and conformational changes

  • Computational Methods:

    • Molecular docking to predict binding modes of different substrates

    • Molecular dynamics simulations to study the dynamics of substrate-protein interactions

    • Homology modeling based on related transporters with known structures

These approaches can be adapted from methods used to study other membrane transporters, with appropriate modifications to account for the specific properties of dctA and its substrates.

How can functional differences between dctA variants from different Xanthomonas strains be characterized?

Characterizing functional differences between dctA variants requires a systematic comparative approach:

  • Sequence Comparison and Analysis:

    • Align dctA sequences from different Xanthomonas strains and pathovars

    • Identify conserved regions and variable domains

    • Use computational tools to predict the functional significance of sequence variations

  • Heterologous Expression System:

    • Express different dctA variants in a common E. coli background lacking endogenous C4-dicarboxylate transporters

    • Ensure comparable expression levels by using the same vector and regulatory elements

    • Verify proper membrane localization using fluorescent protein fusions or membrane fractionation

  • Functional Assays:

    • Compare growth rates on minimal media with different C4-dicarboxylates as sole carbon sources

    • Measure transport kinetics using radioisotope-labeled substrates

    • Determine substrate specificity profiles for each variant

  • Domain Swapping and Site-Directed Mutagenesis:

    • Create chimeric proteins by swapping domains between variants

    • Introduce specific mutations to convert one variant to another

    • Test the impact on transport function and substrate specificity

  • In planta Complementation Studies:

    • Introduce different dctA variants into a dctA deletion mutant

    • Compare their ability to restore virulence and in planta growth

    • Assess host range changes associated with different variants

This approach would build on the molecular techniques described for other Xanthomonas studies, including triparental mating for plasmid mobilization and homologous recombination for generating mutants .

What are the emerging technologies for studying membrane transporters like dctA?

Several emerging technologies hold promise for advancing our understanding of membrane transporters like dctA:

  • Single-Molecule Techniques:

    • Single-molecule FRET to observe conformational changes in real-time

    • High-speed atomic force microscopy (HS-AFM) to visualize structural dynamics

    • Nanodiscs and styrene-maleic acid lipid particles (SMALPs) for maintaining native-like membrane environments

  • Advanced Structural Biology Methods:

    • Serial femtosecond crystallography using X-ray free-electron lasers (XFELs)

    • Cryo-electron tomography for visualizing transporters in their cellular context

    • Integrative structural biology approaches combining multiple techniques (NMR, cryo-EM, crosslinking-MS)

  • Genetic and Genomic Technologies:

    • CRISPR-Cas9 for precise genome editing in Xanthomonas

    • Deep mutational scanning to comprehensively map sequence-function relationships

    • Single-cell RNA-Seq to capture heterogeneity in bacterial populations during infection

  • Computational Approaches:

    • Machine learning for predicting transport mechanisms from sequence data

    • Enhanced sampling molecular dynamics simulations to capture rare events in transport cycles

    • Quantum mechanics/molecular mechanics (QM/MM) simulations for studying substrate binding and transport

Implementing these technologies would require adaptation to the specific challenges of studying membrane proteins in bacterial pathogens, but they offer unprecedented potential for gaining mechanistic insights into dctA function and regulation.

How might dctA be targeted for developing novel antimicrobial strategies?

The potential of dctA as a target for novel antimicrobial strategies can be explored through several approaches:

  • Inhibitor Development:

    • Rational design of competitive inhibitors based on structural knowledge of the substrate binding site

    • High-throughput screening of chemical libraries for compounds that block transport activity

    • Fragment-based drug discovery to identify building blocks for inhibitor design

  • Vaccine Development:

    • Assess exposed regions of dctA as potential antigens

    • Develop peptide vaccines targeting conserved extracellular loops

    • Test immunogenicity and protective efficacy in plant models

  • Metabolic Manipulation:

    • Develop strategies to alter plant C4-dicarboxylate availability during infection

    • Engineer plants to produce toxic dicarboxylate analogs that are transported by dctA

    • Create metabolic changes in the apoplast that reduce the efficacy of dctA-mediated transport

  • Delivery Systems for Targeting:

    • Develop bacteriophage-based delivery of dctA inhibitors

    • Design nanoparticles for targeted delivery to bacterial cells

    • Create plant-expressed RNA interference constructs targeting dctA expression

These approaches would build on established techniques for molecular manipulation in Xanthomonas, including the genetic tools described for creating deletion mutants and expressing recombinant proteins .

What are the key challenges in studying recombinant dctA from X. campestris pv. vesicatoria?

The study of recombinant dctA from X. campestris pv. vesicatoria faces several significant challenges:

  • Membrane Protein Expression and Purification:

    • Obtaining sufficient quantities of properly folded protein

    • Maintaining native structure during solubilization and purification

    • Selecting appropriate detergents or membrane mimetics

    • Preventing aggregation during concentration and storage

  • Functional Characterization:

    • Developing reliable assays for transport activity

    • Distinguishing specific transport from non-specific leakage

    • Reconstituting activity in artificial membrane systems

    • Correlating in vitro measurements with in vivo function

  • Structural Studies:

    • Obtaining crystals suitable for X-ray diffraction

    • Capturing different conformational states of the transport cycle

    • Resolving high-resolution structures in native-like environments

    • Interpreting structural data in the context of the transport mechanism

  • In planta Studies:

    • Creating clean genetic knockouts without polar effects

    • Distinguishing direct from indirect effects on virulence

    • Developing suitable models for studying host-pathogen interactions

    • Accounting for redundancy in transport systems

Addressing these challenges requires an integrated approach combining expertise in membrane protein biochemistry, structural biology, molecular genetics, and plant pathology, along with the application of appropriate methodologies for bacterial cultivation, protein expression, and functional characterization .

How can research on dctA contribute to our broader understanding of bacterial pathogenesis?

Research on dctA can provide valuable insights into multiple aspects of bacterial pathogenesis:

  • Metabolic Adaptation During Infection:

    • Understanding how pathogens acquire essential nutrients in planta

    • Revealing metabolic networks that support bacterial growth during different infection stages

    • Identifying metabolic vulnerabilities that could be targeted for disease control

  • Evolution of Host Specificity:

    • Comparing dctA variants across Xanthomonas pathovars with different host ranges

    • Determining if transport specificity contributes to host adaptation

    • Identifying sequence signatures associated with host specialization

  • Systems-Level Understanding of Virulence:

    • Integrating dctA function into broader metabolic and virulence networks

    • Revealing connections between nutrient acquisition and expression of virulence factors

    • Understanding how environmental sensing regulates pathogen behavior

  • Host-Pathogen Co-evolution:

    • Investigating how plants might manipulate dicarboxylate availability as a defense strategy

    • Examining whether dctA is under selective pressure during host-pathogen co-evolution

    • Identifying potential applications for engineering disease resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.