Recombinant Xanthomonas campestris pv. vesicatoria Glucans biosynthesis glucosyltransferase H (opgH)

Shipped with Ice Packs
In Stock

Description

Introduction to Xanthomonas campestris pv. vesicatoria and OpgH

Xanthomonas campestris pv. vesicatoria is a gram-negative, rod-shaped bacterium that causes bacterial leaf spot (BLS) on economically important crops such as peppers and tomatoes. This pathogen produces symptoms throughout the above-ground portions of plants, including leaf spots, fruit spots, and stem cankers . As a phytopathogen, X. campestris pv. vesicatoria employs various virulence factors to facilitate infection and colonization of host plants.

Among these virulence factors, the glucans biosynthesis glucosyltransferase H (opgH) plays a crucial role in the synthesis of osmoregulated periplasmic glucans (OPGs), which are essential for bacterial adaptation to environmental stresses and pathogenicity. OpgH belongs to the glycosyltransferase 2 family and is specifically involved in the biosynthesis pathway of OPGs, which are important for bacterial fitness and virulence under various environmental conditions.

Molecular Structure

OpgH is a large membrane protein with a molecular weight of approximately 97 kDa. The protein displays a complex structural organization consisting of three major cytoplasmic domains interconnected by eight transmembrane segments . This arrangement suggests that OpgH is anchored in the bacterial inner membrane, with its catalytic domains extending into the cytoplasm where they can access the substrate UDP-glucose.

The central cytoplasmic region of OpgH exhibits structural features characteristic of glycosyltransferases of family 2, containing several aspartic acid residues that are essential for OPG synthesis . These conserved residues likely participate in the catalytic mechanism by coordinating the transfer of glucose moieties from UDP-glucose to growing glucan chains.

Osmoregulated Periplasmic Glucans Biosynthesis

OpgH plays a central role in the biosynthesis pathway of osmoregulated periplasmic glucans (OPGs). These periplasmic oligosaccharides are important for bacterial adaptation to environmental changes, particularly osmotic stress. OPGs typically accumulate in the periplasmic space under conditions of low osmolarity and help maintain cell envelope integrity.

In the OPG biosynthesis pathway, OpgH functions as a glucosyltransferase that catalyzes the formation of linear β-1,2-polyglucose chains using UDP-glucose as the substrate . The enzyme's activity is membrane-associated, and the presence of OpgH in inner membrane vesicles is necessary for the production of these glucan polymers. Interestingly, the acyl carrier protein, which normally functions in fatty acid synthesis, is also required for OpgH activity, though the mechanistic basis for this requirement remains unknown .

Membrane Translocation Function

In addition to its catalytic role, OpgH is postulated to form a transmembrane channel through its eight transmembrane segments, facilitating the translocation of nascent OPG molecules from the cytoplasm to the periplasm during synthesis . This dual functionality as both a synthetic enzyme and a transporter makes OpgH particularly interesting from a mechanistic perspective.

Interaction with Other Proteins

OpgH does not function in isolation but interacts with other proteins in the OPG biosynthesis pathway. For example, OpgG, a 56 kDa periplasmic protein, appears to work in concert with OpgH. While OpgG-defective mutants are unable to form mature OPG molecules or precursors, in vitro assays of OpgH activity in the absence of OpgG produce glucan polymers with a higher degree of polymerization and no branching . This suggests that OpgG may play a role in modulating OpgH activity, possibly by interacting with OpgH during the translocation of nascent molecules and catalyzing the addition of branches to the linear glucan chains.

Expression Systems and Purification

Recombinant Xanthomonas campestris pv. vesicatoria OpgH protein is typically produced in Escherichia coli expression systems. The protein is expressed with an N-terminal His-tag to facilitate purification through affinity chromatography methods. The recombinant protein encompasses the full-length sequence (amino acids 1-645) of the native OpgH protein .

Plant Pathology Research

The recombinant OpgH protein serves as an important tool for studying the molecular mechanisms underlying Xanthomonas pathogenicity. By investigating the structure-function relationships of OpgH, researchers can better understand how bacterial pathogens adapt to plant host environments and cause disease. This knowledge is crucial for developing novel strategies to control bacterial plant diseases, which cause significant economic losses in agriculture worldwide.

Drug Target Identification

Given the importance of OpgH in bacterial pathogenicity, this protein represents a potential target for the development of antimicrobial compounds that could inhibit bacterial growth or attenuate virulence. The recombinant protein allows for high-throughput screening of chemical libraries to identify inhibitors that could serve as lead compounds for the development of new agricultural bactericides.

Comparative Analysis with Other Xanthomonas Species

Research has revealed interesting connections between OpgH in X. campestris pv. vesicatoria and similar enzymes in other Xanthomonas species. For instance, OpgD from X. campestris pv. campestris has been discovered to convert linear β-1,2-glucan to α-1,6-cyclized β-1,2-glucohexadecaose (CβG16α), which is vital for infecting model organisms like Arabidopsis thaliana and Nicotiana benthamiana . This suggests that different but related enzymes within the Xanthomonas genus may catalyze specific reactions in glucan metabolism pathways that contribute to pathogenicity.

Structural and functional analyses have revealed that OpgD from X. campestris pv. campestris possesses an anomer-inverting transglycosylation mechanism, which is unprecedented among glycoside hydrolase family enzymes . This finding has introduced a new concept in the reaction mechanisms of glycoside hydrolase enzymes and suggests further diversity of reaction products among related enzyme families.

Role in Glycan Metabolism Pathways

Recent studies have placed OpgH within the broader context of bacterial glycan metabolism pathways. The enzyme is specifically involved in the pathway of osmoregulated periplasmic glucan (OPG) biosynthesis, which is important for bacterial adaptation to environmental stresses . Understanding the precise role of OpgH in these pathways may provide insights into bacterial stress responses and adaptation mechanisms.

Future Research Directions

Future research on OpgH is likely to focus on several key areas:

  1. Detailed structural characterization of the membrane domains and their role in glucan translocation

  2. Elucidation of the precise catalytic mechanism and identification of key residues involved in substrate binding and catalysis

  3. Investigation of the regulation of OpgH activity in response to environmental signals

  4. Development of specific inhibitors targeting OpgH activity as potential bactericides

  5. Engineering of OpgH variants with altered substrate specificity or improved catalytic efficiency for biotechnological applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
opgH; XCV0675; Glucans biosynthesis glucosyltransferase H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-645
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
opgH
Target Protein Sequence
MDGTVTPSPTTTAMPPVSALDAGTPTLPPEAPLAMPEQNLREGSLQVRHQRTSPPGIGVR RFYLIGGTFATTAIAVWVMLSVLWPDGISVLEGCLLGLFVLLFAWIAMSFASAVAGFVTV VARAGRKLGIDPEQPLPTLRSRTALLMPTYNEDPRRLLAGLQAIYESVAETGQLEHFDFF VLSDTTREHIGRAEELVYNELCDRVDGHGRIFYRRRADNAARKAGNVADWVRRFGGSYPQ MLILDADSVMTGDTIVRLVAGMENNPDVGLIQTLPAVVNGQTLFARMQQFGGRVYGPIIA FGVAWWHGAESNYWGHNAIIRTQAFADHAGLPSLRGRKPFGGHVLSHDFVEAALMRRGGW AMHMVPYLQGSYEEGPPTLTDLLIRDRRWCQGNLQHAKVVSAKGLHWISRMHMLIGIGHY FTAPMWGLLMLIGIGIPLAGGGIDLAGDLPFSPARYWHGSSQGNAIWIFICTMFVLLAPK LLGYIALLLNPRELRACGGAFRAAVSILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGW DAQVRDDGKLSWPALFRSYGGLTVFGLFMGAVAYAVSPALAAWMGPVIVGMALSIPVVAL TSLRRTGMALRRAGIFCIPEELDPPKVLVRASELRRAAALEPSLI
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of osmoregulated periplasmic glucans (OPGs).
Database Links

KEGG: xcv:XCV0675

STRING: 316273.XCV0675

Protein Families
Glycosyltransferase 2 family, OpgH subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.