Recombinant Xanthomonas campestris pv. vesicatoria Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Xanthomonas campestris pv. vesicatoria Lipid A export ATP-binding/permease protein MsbA (msbA) is a bacterial ATP-binding cassette (ABC) transporter critical for lipid A and lipopolysaccharide (LPS) transport in gram-negative pathogens. Produced via recombinant DNA technology in E. coli, this protein enables mechanistic studies of bacterial membrane biogenesis and antibiotic resistance .

Primary Structure

PropertyDetails
UniProt IDQ3BTC8
Protein Length589 amino acids (Full-length)
Amino Acid SequenceMTISTDRPAP... (Full sequence provided in Table 1)
TagN-terminal His tag
Expression SystemEscherichia coli
Molecular Weight~66 kDa (calculated)

Table 1: Key structural properties of recombinant MsbA .

Tertiary Structure

MsbA adopts an inward-facing conformation with a transmembrane portal wide enough to accommodate lipid A. Structural studies in Salmonella typhimurium homologs reveal:

  • A central cavity lined with hydrophobic residues for lipid A binding .

  • ATP-binding domains (NBDs) that drive conformational changes during transport .

  • Surface-exposed clefts hypothesized as lipid A docking sites post-transport .

Biochemical Properties

ParameterSpecification
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol
StabilityStable at -80°C; avoid freeze-thaw cycles

Table 2: Biochemical specifications of recombinant MsbA .

Functional Role in Bacterial Physiology

MsbA is essential for:

  • Lipid A Transport: Shuttling lipid A (endotoxin precursor) from the inner membrane’s cytoplasmic leaflet to the periplasmic leaflet .

  • LPS Assembly: Enabling outer membrane biogenesis, a key virulence factor in gram-negative bacteria .

  • Pathogen Survival: Deletion of msbA homologs in Xanthomonas spp. disrupts membrane integrity and virulence .

Mechanism of Lipid A Transport

  • "Trap and Flip" Model: MsbA captures lipid A in its transmembrane cavity, induces a conformational shift via ATP hydrolysis, and releases it into the periplasm .

  • ATP-Dependent Dynamics: NBD dimerization triggers a switch from inward- to outward-facing states, enabling substrate extrusion .

Pathogenicity Link

  • In Xanthomonas campestris pv. vesicatoria, MsbA supports virulence by maintaining LPS integrity, which is critical for evading plant immune responses .

  • Mutations in msbA disrupt membrane stability, reducing bacterial survival in hostile host environments .

Applications in Research

  • Antibiotic Development: Target for inhibitors disrupting LPS biogenesis (e.g., novel gram-negative antibiotics) .

  • Structural Biology: Tool for studying ABC transporter dynamics via cryo-EM or X-ray crystallography .

  • Plant Pathology: Model for understanding Xanthomonas-host interactions and black rot disease mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please specify them in your order, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a particular tag type preference, please inform us, and we will prioritize its development.
Synonyms
msbA; XCV2254; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
msbA
Target Protein Sequence
MTISTDRPAPVSSWRTYRRLLAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGVAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAQLLQAADQTLSSHQEVKIYGAQQTEMERYGALANR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGTVPLTRAKGLIEFRDVTARYPGQVN PALADVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAEAGQILLDGHPVQAYALADLR RQIALVGQQVMLFDGSIADNVAFGEMRNADAGQLERAILGANAMEFVAQLPEGLQSHVGT KGGRLSGGQRQRLAIARAMLKDAPVLILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHQLLAQGGLYSHLHGMQFRERQA
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xcv:XCV2254

STRING: 316273.XCV2254

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MsbA and what molecular role does it play in bacterial cell membranes?

MsbA is a prokaryotic integral membrane protein belonging to the ATP-binding cassette (ABC) transporter superfamily. It plays a critical role in lipopolysaccharide (LPS) biogenesis by facilitating the transport of the LPS precursor lipooligosaccharide (LOS) from the cytoplasmic to the periplasmic leaflet of the inner membrane . This flippase activity is essential for the proper formation of the outer membrane in gram-negative bacteria, making MsbA vital for bacterial survival .

In molecular terms, MsbA functions by coupling ATP hydrolysis to substrate translocation across the membrane. The protein contains two distinct domains: transmembrane domains (TMDs) that form the translocation pathway and nucleotide-binding domains (NBDs) that bind and hydrolyze ATP to drive the transport process. This energy-dependent transport system is crucial for maintaining the asymmetric structure of bacterial membranes, with phospholipids comprising the inner leaflet and lipopolysaccharides as the major component of the outer leaflet .

What are the optimal storage and handling conditions for recombinant MsbA protein?

Recombinant MsbA protein requires specific storage and handling conditions to maintain its structural integrity and functional activity. Based on established protocols, the following guidelines should be implemented:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized specifically for MsbA stability

Handling recommendations:

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein activity

  • For ongoing experiments, prepare working aliquots and store at 4°C for up to one week

  • When thawing frozen stocks, use gentle thawing methods to preserve protein structure

Implementation of these storage and handling protocols is critical for maintaining the native conformation of MsbA, especially considering its complex membrane-spanning architecture and sensitivity to denaturation.

How can native mass spectrometry be effectively employed to study MsbA-lipid and MsbA-nucleotide interactions?

Native mass spectrometry (MS) has emerged as a powerful technique for investigating the interactions between MsbA and its binding partners, including lipids and nucleotides. This methodology preserves non-covalent interactions during the transition from solution to the gas phase, allowing for the direct observation of protein complexes.

For studying MsbA interactions, the following methodological approach is recommended:

  • Sample preparation:

    • Purify MsbA in detergent micelles or nanodiscs to maintain its native membrane environment

    • Exchange the buffer to MS-compatible solutions (typically ammonium acetate)

    • Incubate MsbA with nucleotides (ATP/ADP) and/or lipid substrates at physiologically relevant concentrations

  • MS acquisition parameters:

    • Use gentle ionization conditions to preserve non-covalent interactions

    • Optimize collision energy to release MsbA from detergent/nanodiscs without disrupting ligand binding

    • Apply narrow m/z ranges for improved resolution of bound species

  • Data analysis:

    • Quantify the relative abundances of apo, nucleotide-bound, and lipid-bound MsbA species

    • Calculate binding affinities based on the distribution of bound species

    • Characterize how lipid binding influences nucleotide preference

This approach has successfully demonstrated that MsbA has a higher affinity for ADP compared to ATP, but interestingly, the LPS-precursor Kdo2-lipid A (KDL) can modulate this selectivity, enhancing ATP binding . This methodological framework provides crucial insights into the allosteric regulation of MsbA activity by its physiological substrates.

What structural transitions does MsbA undergo during its transport cycle?

MsbA undergoes a series of distinct conformational changes during its transport cycle, transitioning between inward-facing and outward-facing states. Recent structural studies have captured several critical conformational states, providing snapshots of the transport mechanism:

  • Inward-facing conformations:

    • At least four distinct open, inward-facing structures have been identified, varying in their degree of openness

    • These structures represent the substrate-accepting state, where the central cavity is accessible from the cytoplasmic side of the membrane

    • The nucleotide-binding domains (NBDs) are separated in these conformations

  • Outward-facing conformation:

    • A 2.7 Å-resolution structure shows MsbA in an open, outward-facing conformation

    • This state is characterized by KDL binding at the exterior site

    • The NBDs adopt a distinct nucleotide-free structure in this conformation

  • Transitional states:

    • ATP binding induces NBD dimerization

    • This conformational change transmits to the transmembrane domains, causing the central cavity to open to the periplasmic side

    • After ATP hydrolysis, the transporter reverts to the inward-facing conformation

These structural transitions highlight the dynamic nature of MsbA and provide crucial insights into how ABC transporters couple ATP hydrolysis to substrate translocation across the membrane.

What are the potential approaches for targeting MsbA in antibiotic development?

MsbA represents a promising antibiotic target due to its essential role in bacterial membrane formation. Several strategic approaches for targeting MsbA in drug discovery efforts include:

  • Direct inhibition strategies:

    • Targeting the ATPase activity by developing compounds that compete with ATP binding

    • Designing molecules that interfere with the conformational changes necessary for the transport cycle

    • Developing substrate mimics that occupy the substrate-binding pocket without being transported

  • Computational screening approaches:

    • Utilizing computational methods similar to those employed in P-glycoprotein inhibitor discovery

    • Virtual screening of compound libraries against the various conformational states of MsbA

    • Structure-based drug design targeting specific binding pockets identified in crystal structures

  • Challenges in inhibitor development:

    • MsbA's ability to transport a wide variety of drug-like compounds complicates the search for effective inhibitors

    • Compounds designed to inhibit MsbA might themselves be transported by the protein, reducing their effective concentration

    • Selectivity between bacterial MsbA and human ABC transporters presents another challenge to overcome

Despite these challenges, the essential nature of MsbA in gram-negative bacteria and its absence in mammalian cells make it an attractive target for novel antibiotics, particularly against resistant strains.

How can researchers differentiate between specific and non-specific interactions when evaluating potential MsbA inhibitors?

Distinguishing between specific inhibitory effects and non-specific interactions is crucial when evaluating compounds targeting MsbA. The following methodological approaches can help researchers make this critical distinction:

  • Control experiments:

    • Use an MsbA mutant with impaired ATPase activity as a negative control

    • Perform parallel assays with structurally related ABC transporters to assess selectivity

    • Include detergent controls to identify compounds that disrupt membranes non-specifically

  • Biochemical validation:

    • Establish dose-response relationships and calculate IC50 values

    • Determine the mechanism of inhibition (competitive, non-competitive, or uncompetitive)

    • Assess whether compounds affect ATP binding, ATP hydrolysis, or substrate binding

  • Biophysical confirmation:

    • Use native mass spectrometry to directly observe compound binding to MsbA

    • Employ thermal shift assays to measure compound-induced stabilization

    • Utilize surface plasmon resonance to determine binding kinetics and affinity

  • Structural validation:

    • Obtain co-crystal structures of MsbA with lead compounds

    • Use molecular dynamics simulations to predict binding modes

    • Perform mutagenesis of predicted binding site residues to confirm the binding mode

By implementing this comprehensive validation strategy, researchers can effectively differentiate between compounds that specifically inhibit MsbA function and those that interact non-specifically or affect membrane integrity, leading to more promising antibiotic candidates.

How do MsbA proteins from different Xanthomonas campestris pathovars compare structurally and functionally?

Comparative analysis of MsbA proteins from different Xanthomonas campestris pathovars reveals both conservation and variation in sequence and potentially in function. The following table highlights key comparisons between MsbA from X. campestris pv. vesicatoria and X. campestris pv. campestris:

Functional studies comparing these variants could provide valuable insights into how subtle sequence differences influence transport kinetics, substrate specificity, or regulatory mechanisms across different Xanthomonas strains.

What methodological approaches are most effective for studying MsbA's role in bacterial antibiotic resistance?

Investigating MsbA's contribution to antibiotic resistance requires a multi-faceted methodological approach that integrates genetic, biochemical, and pharmacological techniques:

  • Genetic manipulation strategies:

    • Generate conditional knockdown strains to assess the impact of reduced MsbA expression on antibiotic susceptibility

    • Create point mutations in key functional residues to identify regions critical for antibiotic resistance

    • Perform complementation studies with MsbA variants from different bacterial species to evaluate functional conservation

  • Biochemical transport assays:

    • Develop fluorescent or radiolabeled substrate assays to directly measure transport activity

    • Assess the impact of antibiotics on MsbA-mediated lipid A/LPS transport

    • Determine whether antibiotics are substrates for MsbA-mediated efflux

  • Structural biology approaches:

    • Use cryo-EM or X-ray crystallography to capture MsbA structures in the presence of antibiotics

    • Identify binding sites and conformational changes induced by antibiotic binding

    • Compare structures with resistant and susceptible MsbA variants

  • Whole-cell antibiotic susceptibility testing:

    • Perform minimum inhibitory concentration (MIC) assays with MsbA overexpression or mutant strains

    • Use checkerboard assays to identify synergistic combinations of MsbA inhibitors and established antibiotics

    • Assess the impact of MsbA inhibitors on the efficacy of last-resort antibiotics against resistant strains

These methodological approaches provide a comprehensive framework for understanding how MsbA contributes to antibiotic resistance in gram-negative bacteria and how this mechanism might be targeted to overcome resistance challenges.

What are the common challenges in purifying functional recombinant MsbA and how can they be addressed?

Purifying functional membrane proteins like MsbA presents several technical challenges. The following troubleshooting guide addresses common issues and their solutions:

  • Low expression yields:

    • Problem: Membrane protein overexpression can be toxic to host cells

    • Solution: Use tightly regulated expression systems, lower induction temperatures (16-20°C), and specialized expression hosts designed for membrane proteins

    • Validation: Monitor expression using Western blotting with anti-His or anti-MsbA antibodies

  • Protein aggregation:

    • Problem: Improper folding leading to inclusion body formation

    • Solution: Co-express with molecular chaperones, optimize detergent type and concentration during solubilization, and consider fusion tags that enhance solubility

    • Validation: Assess monodispersity using size-exclusion chromatography and dynamic light scattering

  • Loss of activity during purification:

    • Problem: Detergents may strip essential lipids or destabilize the protein

    • Solution: Supplement purification buffers with lipids, use milder detergents or nanodiscs, and include stabilizing agents such as glycerol

    • Validation: Perform ATPase activity assays at each purification step to track functional integrity

  • Storage instability:

    • Problem: Activity loss during storage

    • Solution: Store in 50% glycerol at -20°C or -80°C, avoid repeated freeze-thaw cycles, and prepare small working aliquots

    • Validation: Compare ATPase activity of fresh and stored samples to establish stability profiles

Implementing these strategies helps overcome the inherent challenges of membrane protein purification, ensuring the isolation of functionally active MsbA suitable for structural and biochemical studies.

How can researchers ensure the validity of structural data when studying different conformational states of MsbA?

Validating structural data for conformationally dynamic proteins like MsbA requires rigorous quality control measures and complementary approaches:

  • Structural validation metrics:

    • Assess resolution, R-factors, and geometric parameters for X-ray crystallography data

    • For cryo-EM structures, evaluate local resolution maps, FSC curves, and angular distribution of particles

    • Examine Ramachandran plots, clash scores, and side-chain rotamer statistics

  • Functional correlation:

    • Design mutations that should affect specific conformational states based on structural data

    • Test these mutations in functional assays to confirm the biological relevance of observed conformations

    • Correlate structural information with biochemical data on nucleotide and substrate binding

  • Complementary structural methods:

    • Validate crystallographic or cryo-EM structures using small-angle X-ray scattering (SAXS) in solution

    • Employ hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Use double electron-electron resonance (DEER) spectroscopy to measure distances between specific residues in different conformational states

  • Computational validation:

    • Perform molecular dynamics simulations to test the stability of observed conformations

    • Use enhanced sampling methods to explore the conformational landscape

    • Calculate energy barriers between different states to assess the likelihood of observed transitions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.