Recombinant Xanthomonas campestris pv. vesicatoria NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xanthomonas campestris pv. vesicatoria NADH-Quinone Oxidoreductase Subunit K (nuoK)

The recombinant Xanthomonas campestris pv. vesicatoria NADH-quinone oxidoreductase subunit K (nuoK) is a bacterial protein critical to the NADH dehydrogenase I complex, which is part of the electron transport chain in prokaryotes . This enzyme facilitates electron transfer from NADH to quinones, contributing to cellular respiration and ATP synthesis. The recombinant form is engineered with an N-terminal His-tag for purification and research applications .

Gene and Protein Information

  • Gene Name: nuoK (XCV2843)

  • UniProt ID: Q3BRN9

  • EC Number: 1.6.99.5 (NADH-quinone oxidoreductase)

  • Alternative Names:

    • NADH dehydrogenase I subunit K

    • NDH-1 subunit K

The amino acid sequence (MITLGHLLGLGAVLFCISLAGIFLNRKNVIVLLMSIELMLLSVNVNFIAFSRELGDTAGQ LFVFFILTVAAAEAAIGLAILVTLFRTRRTINVAEVDTLKG) highlights conserved motifs critical for membrane integration and quinone interaction .

Role in Bacterial Respiration

nuoK is a subunit of the NADH dehydrogenase I (NDH-1) complex, which is essential for transferring electrons from NADH to ubiquinone in the bacterial electron transport chain. This process generates a proton gradient for ATP synthesis .

Pathogenicity and Related Systems

While nuoK itself is not directly linked to virulence, X. campestris pv. vesicatoria employs other respiratory subunits (e.g., nuoH) and secretion systems (e.g., type II and III secretion) to infect plants . For example, the hrp gene cluster regulates effector proteins that suppress host immunity .

Comparative Insights

  • nuoH: A related subunit (Q3BRN6) is expressed in mammalian cells and shares functional roles in NDH-1 but differs in expression systems and purification tags .

  • Protease Secretion: X. campestris pv. vesicatoria secretes virulence-associated proteases and xylanases via type II secretion systems, though nuoK is not directly involved in this process .

Applications in Research and Biotechnology

  • Enzyme Studies: Used to investigate electron transport mechanisms and quinone binding.

  • Vaccine Development: Potential antigen for targeting Xanthomonas infections, though no direct studies are cited.

  • Protein-Protein Interactions: His-tag facilitates pull-down assays to identify binding partners in NDH-1 assembly .

Handling and Stability Considerations

RecommendationDetail
Freeze-Thaw CyclesAvoid repeated cycles to prevent degradation
Glycerol Addition5–50% final concentration recommended for long-term storage
ReconstitutionUse sterile water; centrifuge vial before opening to pellet contents

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; XCV2843; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
nuoK
Target Protein Sequence
MITLGHLLGLGAVLFCISLAGIFLNRKNVIVLLMSIELMLLSVNVNFIAFSRELGDTAGQ LFVFFILTVAAAEAAIGLAILVTLFRTRRTINVAEVDTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: xcv:XCV2843

STRING: 316273.XCV2843

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of NADH-quinone oxidoreductase subunit K in Xanthomonas campestris?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the larger NADH-quinone oxidoreductase complex (also known as Complex I or NDH-1), which plays a crucial role in the respiratory chain. In Xanthomonas campestris pv. campestris, nuoK consists of 101 amino acids with the sequence: MITLGHLLGLGAVLFCISLAGIFLNRKNVIVLLMSIELLLSVNVNFIAFSRELGDTAGQLFVFFILTVAAAEAAIGLAILVTLFRTRRTINVAEVDTLKG .

The protein functions as part of an enzyme complex with EC number 1.6.99.5 and is involved in electron transport within the bacterial respiratory chain. The nuoK subunit, like other components of this complex, contributes to the proton-translocating function of NADH-quinone oxidoreductase, which is essential for bacterial energy metabolism .

How does the bacterial NDH-1 complex differ structurally from its mammalian counterpart?

The bacterial NADH-quinone oxidoreductase (NDH-1) represents a structurally simpler version of the mammalian Complex I. While the mammalian mitochondrial enzyme contains more than 40 subunits, bacterial counterparts in organisms like Paracoccus denitrificans and Thermus thermophilus HB-8 consist of only 14 subunits . This structural simplicity makes bacterial systems valuable models for understanding the fundamental mechanisms of these enzyme complexes.

Despite these differences, key functional regions appear to be conserved between bacterial and mammalian systems. Research has established that homologous subunits (such as PSST in mitochondria and NQO6 in bacteria) have conserved inhibitor-binding sites and play similar roles in electron transfer, suggesting evolutionary conservation of critical functional domains across diverse species .

What are the optimal storage and handling conditions for recombinant Xanthomonas campestris nuoK protein?

For optimal stability and activity of recombinant Xanthomonas campestris nuoK protein, the following storage and handling protocols are recommended:

  • Standard storage: -20°C in Tris-based buffer with 50% glycerol

  • Extended storage: -80°C (preferred for long-term preservation)

  • Working aliquots: Can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

  • For experiments requiring protein transfer, maintain cold chain protocols throughout handling

When designing experiments, it's important to note that the tag type on the recombinant protein may vary depending on the production process, which could affect certain experimental parameters such as antibody recognition or binding affinity studies .

What experimental approaches are most effective for studying electron transfer mechanisms in nuoK-containing complexes?

Investigating electron transfer mechanisms in NADH-quinone oxidoreductase involves multiple experimental approaches:

  • Photoaffinity labeling: Using ligands such as (trifluoromethyl)diazirinyl[3H]pyridaben ([3H]TDP) can provide insights into binding sites and subunit interactions. This technique has proven effective in studying homologous complexes by combining inhibitor potency with photoreactive groups and high-specific activity tritium labeling .

  • Inhibitor studies: Complex I and NDH-1 are sensitive to structurally diverse inhibitors including rotenone, piericidin A, bullatacin, and pyridaben. Competitive binding assays using these inhibitors can help characterize binding sites within the complex and elucidate functional relationships between subunits .

  • Protein sequencing and immunoprecipitation: These techniques have successfully identified specific subunits involved in inhibitor binding and electron transfer functions in related complexes. Similar approaches could be applied to study nuoK's role in the NADH-quinone oxidoreductase complex .

  • Site-directed mutagenesis: Creating specific mutations in conserved regions of the nuoK subunit can help identify amino acids critical for electron transfer, proton pumping, or structural integrity.

What biosafety regulations apply to research involving recombinant Xanthomonas campestris nuoK?

Research involving recombinant Xanthomonas campestris proteins, including nuoK, falls under specific regulatory frameworks outlined in the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key compliance requirements include:

  • Institutional oversight: Research conducted at or sponsored by institutions receiving NIH support for recombinant or synthetic nucleic acid research must comply with NIH Guidelines, regardless of the specific funding source for individual projects .

  • Biosafety review: Experiments must be reviewed and approved by an Institutional Biosafety Committee (IBC) or equivalent review body. This applies to domestic research and international collaborations .

  • Containment principles: Appropriate biosafety practices and containment principles must be implemented based on risk assessment. These principles apply to the construction and handling of recombinant nucleic acid molecules, synthetic nucleic acid molecules, and cells/organisms containing such molecules .

  • International research considerations: For research conducted abroad, compliance with host country rules is required. If no such rules exist, NIH-approved IBC review and approval from an appropriate national governmental authority are necessary. Safety practices employed abroad must be reasonably consistent with NIH Guidelines .

What are the recommended analytical methods for characterizing recombinant nuoK protein purity and activity?

For comprehensive characterization of recombinant nuoK protein, researchers should employ multiple analytical methods:

Table 1: Analytical Methods for Characterizing Recombinant nuoK Protein

MethodApplicationParametersExpected Results
SDS-PAGEPurity assessment12-15% gel; reducing conditionsSingle band at approximately 11 kDa
Western blotIdentity confirmationAnti-nuoK or anti-tag antibodiesSpecific immunoreactivity at expected MW
Mass spectrometryPrecise mass determination; sequence coverageMALDI-TOF or LC-MS/MSMolecular weight matching theoretical value of 11 kDa
Enzyme activity assayFunctional assessmentNADH oxidation rate measurementActivity consistent with NADH-quinone oxidoreductase function
Circular dichroismSecondary structure analysisFar-UV spectrum (190-260 nm)Predominantly α-helical structure
Dynamic light scatteringAggregation assessmentHydrodynamic radius measurementMonodisperse preparation

Protein purity should be assessed using SDS-PAGE with appropriate molecular weight standards. For functional characterization, enzymatic activity can be measured by monitoring NADH oxidation rates spectrophotometrically when the protein is reconstituted with other subunits of the complex.

How can researchers effectively design expression systems for producing functional recombinant nuoK?

Designing effective expression systems for membrane proteins like nuoK requires careful consideration of multiple factors:

  • Expression vector selection: For membrane proteins like nuoK, specialized vectors containing solubility-enhancing fusion partners (e.g., MBP, SUMO, thioredoxin) can improve expression and folding. Consider codon optimization for the expression host.

  • Host strain selection: E. coli strains like C41(DE3) and C43(DE3), derived from BL21(DE3), are often preferred for membrane protein expression as they better tolerate the toxic effects of membrane protein overexpression.

  • Induction conditions: Lower temperatures (16-25°C) and reduced inducer concentrations can enhance proper folding of membrane proteins. Consider using auto-induction media for gradual protein expression.

  • Membrane protein extraction: Optimize detergent screening (e.g., DDM, LDAO, Fos-choline) for efficient extraction of correctly folded nuoK from membranes. Different detergents may affect protein stability and functionality differently.

  • Purification strategy: Implement a two-step purification protocol using affinity chromatography followed by size exclusion chromatography to obtain high-purity protein suitable for functional and structural studies.

How does nuoK from Xanthomonas campestris compare to homologous proteins in other bacterial species?

Comparative analysis of nuoK across bacterial species reveals important evolutionary and functional patterns:

Table 2: Comparative Features of nuoK Homologs Across Bacterial Species

FeatureX. campestris pv. campestrisOther Xanthomonas spp.P. denitrificansE. coli
Length (amino acids)101 100-10298-103100
Transmembrane domainsMultiple (hydrophobic regions) Similar patternSimilar patternSimilar pattern
Conserved motifsLLSVNVNFIAFSRE Highly conservedModerately conservedModerately conserved
Role in complexPart of proton-translocating mechanismSimilarSimilarSimilar
Inhibitor sensitivityExpected similar to Complex I VariableWell-characterizedWell-characterized

The nuoK subunit shows significant conservation across species, particularly in transmembrane regions and functional motifs involved in proton translocation. The hydrophobic nature of the protein (indicated by its amino acid sequence containing multiple glycine and leucine residues) is consistent with its role as a membrane-embedded component of the NADH-quinone oxidoreductase complex .

The high degree of sequence conservation suggests a critical functional role that has been maintained throughout bacterial evolution, making comparative studies valuable for understanding fundamental aspects of respiratory chain function across diverse bacterial species.

What are the current challenges in studying the proton-translocation mechanism of nuoK within the NADH-quinone oxidoreductase complex?

Research into the proton-translocation mechanism of nuoK faces several significant challenges:

  • Structural complexity: The multi-subunit nature of NADH-quinone oxidoreductase complicates structural studies. While bacterial versions have fewer subunits than mammalian ones, the complex remains challenging to study in its entirety .

  • Membrane protein challenges: As a membrane protein, nuoK presents difficulties in expression, purification, and crystallization for structural studies.

  • Functional reconstitution: Studying nuoK function often requires reconstitution of the entire complex or significant portions of it, as the isolated subunit may not maintain native functionality.

  • Terminal electron transfer mechanisms: A major unresolved question in the field is "the location and mechanism of the terminal electron transfer step from iron–sulfur cluster N2 to quinone" . Understanding nuoK's role in this process requires sophisticated biophysical techniques.

  • Inhibitor binding sites: While studies with photoaffinity probes have identified binding sites in homologous systems, detailed mapping of inhibitor interactions in nuoK specifically requires further investigation .

What are common challenges in recombinant nuoK expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant nuoK protein:

Table 3: Troubleshooting Guide for nuoK Expression and Purification

ChallengePossible CausesSolutions
Low expression yieldProtein toxicity; Inefficient transcription/translationUse specialized strains (C41/C43); Lower induction temperature (16-20°C); Optimize codon usage
Protein aggregationImproper folding; Ineffective solubilizationScreen multiple detergents; Add stabilizing agents (glycerol, specific lipids); Consider fusion partners
Loss of activityDenaturation during purification; Cofactor lossMaintain cold conditions throughout; Add stabilizing agents; Consider native purification approaches
Protein degradationProtease activity; Inherent instabilityAdd protease inhibitors; Reduce purification time; Store with stabilizing agents
Poor purityNon-specific binding; Inefficient chromatographyOptimize imidazole concentrations; Consider tandem purification; Use size exclusion as final step

For optimal results with nuoK expression, maintaining the protein in buffer containing 50% glycerol and storing at appropriate temperatures (-20°C for regular storage, -80°C for extended storage) is recommended. Additionally, avoiding repeated freeze-thaw cycles and preparing working aliquots for short-term use can help maintain protein integrity .

How can researchers accurately assess the structural integrity of recombinant nuoK in different experimental conditions?

Assessing structural integrity of recombinant nuoK requires multiple complementary approaches:

When presenting structural assessment data, researchers should follow standard guidelines for scientific tables and figures, ensuring that the meaning is clear at a glance while providing sufficient detail for thorough analysis .

What are promising research directions for exploring the role of nuoK in bacterial pathogenicity?

Several emerging research areas connect nuoK function to bacterial pathogenicity:

  • Metabolic adaptation during infection: As part of the respiratory chain, nuoK's role in energy generation may be critical during host colonization. Research could explore how expression and function of nuoK changes during different stages of infection.

  • Response to host-derived antimicrobials: Studies with Xanthomonas campestris pv. vesicatoria have shown varying sensitivity to antimicrobials like copper among different strains . Investigating whether respiratory chain components like nuoK influence this sensitivity could provide insights into bacterial survival mechanisms.

  • Biofilm formation and maintenance: Energy metabolism is critical for biofilm development. Research examining nuoK's contribution to biofilm-associated energy homeostasis could reveal new targets for disrupting bacterial communities.

  • Stress response mechanisms: Understanding how nuoK function adapts under stress conditions relevant to host environments (oxidative stress, pH fluctuations, nutrient limitation) could identify vulnerability points in bacterial metabolism.

  • Comparative genomics: Exploring sequence and functional variations in nuoK across pathogenic and non-pathogenic Xanthomonas strains may reveal adaptations specifically associated with virulence.

How might inhibitor studies of nuoK contribute to development of new antimicrobial strategies?

Inhibitor studies focusing on nuoK offer promising avenues for antimicrobial development:

  • Targeted disruption: Research has shown that NADH-quinone oxidoreductase is sensitive to various inhibitors including rotenone, piericidin A, bullatacin, and pyridaben . Investigating how these inhibitors interact with nuoK specifically could lead to more targeted antimicrobial compounds.

  • Resistance mechanisms: Understanding how mutations in nuoK might confer resistance to inhibitors could help design combination therapies or next-generation compounds that remain effective against resistant strains.

  • Structure-activity relationships: Detailed mapping of the relationship between inhibitor structures and their effectiveness against nuoK could guide rational design of optimized compounds with improved specificity and reduced toxicity.

  • Species selectivity: Comparative analysis of inhibitor effectiveness across nuoK homologs from different bacterial species could identify compounds with selectivity for specific pathogens, reducing disruption of beneficial microbiota.

  • Novel screening approaches: Development of high-throughput screening assays specifically targeting nuoK function could facilitate discovery of new classes of inhibitors beyond those currently known to affect NADH-quinone oxidoreductase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.