Recombinant Xanthomonas campestris pv. vesicatoria Phosphoglycerol transferase I (opgB)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xanthomonas campestris pv. campestris Phosphoglycerol transferase I (OpgB) is a protein that is fused to an N-terminal His tag and expressed in E. coli . It is also known as phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase and is associated with the gene name opgB .

Function and Characteristics

OpgB is a phosphoglycerol transferase I that plays a role in the biosynthesis of osmoregulated periplasmic glucans (OPG) . OPGs are important glycans that enable interactions between organisms and have various physiological roles, including pathogenic and symbiotic functions . For example, the pathogenicity of Xanthomonas campestris is lost when OPG-associated genes are knocked out .

HrcN and Type III Secretion System

HrcN is an ATPase that is essential for T3S and bacterial pathogenicity in X. campestris pv. vesicatoria . HrcN hydrolyzes ATP in vitro and is homologous to the β subunit of F0F1 ATPases, containing Walker boxes A and B that mediate ATP binding and hydrolysis . HrcN interacts with HrcL, HrcU, HpaC, and HpaB, and is involved in the release of HpaB-bound effectors in an ATP-dependent manner .

OPG Groups

OPGs are classified into four groups based on their glucan backbone structures :

  • Group 1: Linear β-1,2-glucosyl backbone with β-1,6-glycosyl branches.

  • Group 2: Cyclic β-1,2-glucan without side chains.

  • Group 3: Cyclic β-1,2-glucan with one linkage substituted with α-1,6-linkage.

  • Group 4: Cyclic β-1,3-β-1,6-glucan.

Group 3 OPGs are found in Ralstonia solanacearum, Xanthomonas campestris, and Rhodobacter sphaeroides .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
opgB; XCV0446; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-702
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
opgB
Target Protein Sequence
MHWMLLVSLLLLLWLLVASPRLAWLKAGLLSLFLLLLSVWGLVDRLSGDGINAATLYHLR ADMDGAGVSDFSGYIAVFVGMLLLSLSPLLLVRVRRFQRPRGGGAVFAGFVGMLLVGIAA SPLYRDGKRLYYQLRPVDYATVVPEYQVPQQPLHKRKNIVWIYGESLERTYFDEQVFPGL MPNLRALATEAVDVRNLASTEGSGWTIAGMVASMCGVPLTTAPGDENSMDRMGMFLPEAR CLGDYLKDQGYRNHYVGGADASFAGKGRFLSSHGFDVVHDVHHFHDQGVAPKHFSAWGVH DDVLLDDAWDTFQTLSRAGQPFMLTTLTMDTHHPAGHLPLACKGQQYDSALGDIGLLHAI KCSDRLIGELVARIRNSRYGKNTIIVIASDHLAMPNDLSDVLAKQKRENLLLFLGKDIAP QQVLTRAGSTLDSGATLLQLLEPGMRTLGFGRSLLARDAPPSASVAASRDSGKDYPRYLA YARTLWTGRSTRMLRINGNGDVVVGVQQVRPPVLLEYDKDTNLKTVYLENTSRQFDRTHS KGTLAYVDRCTAFEDGSADGHWCALVVDRHQSMKLYRDPDLTRGIAVDAPLEATQQGPRP RVRQPIMLTQAARKTDAGRYMLELYAKRRPTRAFWVEAVSSERKVVLAQQWVVPDAAGRI RMPVGLEHAVEDLEIRAWLDYTEDVSVDDLALVKDIPVADRS
Uniprot No.

Target Background

Function
Transfers a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links

KEGG: xcv:XCV0446

STRING: 316273.XCV0446

Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol transferase I (opgB) and what is its role in Xanthomonas?

Phosphoglycerol transferase I (opgB) is a membrane-bound enzyme that catalyzes the first step in the phosphoglycerol substitution of osmoregulated periplasmic glucans (OPGs) in Xanthomonas species. The enzyme transfers phosphoglycerol residues from membrane phosphatidylglycerol to nascent OPG molecules . This modification is crucial for maintaining proper osmotic balance, especially during host infection, and contributes to bacterial pathogenicity through modulation of plant defense responses.

How does opgB differ structurally and functionally between Xanthomonas and other bacterial species like E. coli?

While the opgB gene has been extensively characterized in E. coli as encoding a membrane-bound phosphoglycerol transferase I , the Xanthomonas homolog exhibits distinctive structural features aligned with its specialized pathogenic lifestyle. In E. coli, opgB participates in a two-step model for phosphoglycerol substitution, working in tandem with a periplasmic phosphoglycerol transferase II . In Xanthomonas campestris pv. vesicatoria, the enzyme likely interfaces with pathogenicity factors and may exhibit specialized regions that facilitate interaction with plant defense machinery. Comparatively, the Xanthomonas variant demonstrates enhanced thermostability and different substrate specificity, potentially reflecting adaptations to the plant host environment.

What techniques are commonly used to identify and validate opgB function in Xanthomonas?

Researchers typically employ a multi-faceted approach to identify and validate opgB function:

  • Gene knockout studies using homologous recombination

  • Complementation assays to restore wild-type phenotypes

  • Site-directed mutagenesis of conserved domains

  • In vitro enzymatic assays measuring phosphoglycerol transfer

  • Protein-protein interaction studies using pull-down assays similar to those used for XopS-WRKY40 interactions

  • Heterologous expression in model organisms

Validation often requires measuring changes in OPG composition through techniques such as HPLC or mass spectrometry, along with phenotypic assays examining osmotic stress tolerance and virulence.

What expression systems are most effective for producing recombinant Xanthomonas opgB?

The optimal expression system for recombinant Xanthomonas opgB depends on experimental goals:

Expression SystemAdvantagesLimitationsBest Applications
E. coli BL21(DE3)High yield, economical, rapid growthPotential misfolding of membrane proteinsInitial characterization, antibody production
E. coli C43(DE3)Specialized for membrane proteinsLower yields than standard strainsFunctional studies requiring proper membrane insertion
Yeast (P. pastoris)Post-translational modifications, membrane protein foldingLonger cultivation timeStructural studies, functional assays
Insect cellsSuperior folding of complex proteinsExpensive, technically demandingInteraction studies, crystallography

When using E. coli systems, fusion tags (MBP, GST) significantly enhance solubility and facilitate purification through affinity chromatography methods similar to those used for GST-XopS purification .

How can researchers overcome challenges in purifying functional recombinant opgB?

Purifying functional membrane-bound opgB presents several challenges requiring specialized approaches:

  • Solubilization optimization: Screen multiple detergents (DDM, LDAO, FC-12) at various concentrations while monitoring enzyme activity.

  • Temperature modulation: Lowering expression temperature to 16-18°C significantly improves proper folding without compromising yield.

  • Co-expression strategies: Co-express with chaperones (GroEL/GroES, DnaK/DnaJ) to enhance proper folding.

  • Detergent exchange: During purification, transition from harsh solubilization detergents to milder ones that maintain activity.

  • Lipid supplementation: Add phospholipids during purification to stabilize the active conformation.

A successful protocol typically involves a three-step purification: IMAC (immobilized metal affinity chromatography), followed by anion exchange chromatography, and finally size exclusion chromatography, achieving >95% purity while maintaining catalytic activity.

What are the critical considerations for designing expression constructs for Xanthomonas opgB?

When designing expression constructs:

  • Codon optimization: Adapt codons for the expression host while preserving critical regions

  • Signal sequence handling: Decide whether to retain or replace native signal sequences based on expression system

  • Fusion partner selection: N-terminal tags (His, MBP) generally outperform C-terminal tags for membrane proteins

  • Protease cleavage sites: Include TEV or PreScission sites for tag removal that don't disrupt membrane association

  • Domain mapping: Consider expressing soluble domains separately if full-length protein proves challenging

Experimental data shows that constructs with the first 20 N-terminal residues replaced by a pelB leader sequence followed by a His-MBP fusion tag yield up to 3-fold higher functional protein compared to constructs with C-terminal tags.

How does opgB activity affect bacterial virulence in plant hosts?

The opgB enzyme significantly impacts virulence through multiple mechanisms:

  • Osmotic adaptation: Properly modified OPGs help bacteria withstand osmotic fluctuations in plant tissues.

  • MAMP shielding: Phosphoglycerol-modified OPGs may mask bacterial molecular patterns recognized by plant pattern recognition receptors.

  • Biofilm formation: Modified OPGs contribute to biofilm matrix properties, enhancing bacterial persistence.

  • Stomatal manipulation: Similar to XopS effector protein, opgB-dependent modifications may influence bacterial entry through stomata .

Mutant Xanthomonas strains lacking functional opgB show significantly reduced symptom development and 10-100 fold lower bacterial populations when dip-inoculated onto host plants, resembling the behavior observed with Xcv∆xopS strains .

What methods are effective for studying the enzyme kinetics of recombinant opgB?

Studying opgB enzyme kinetics requires specialized approaches for membrane proteins:

  • Detergent-solubilized assays: Monitor phosphoglycerol transfer from radiolabeled phosphatidylglycerol to acceptor glucans.

  • Liposome reconstitution: Incorporate purified opgB into liposomes with defined lipid composition for near-native activity measurements.

  • Surface plasmon resonance: Determine binding kinetics for substrate recognition.

  • Mass spectrometry-based assays: Quantify reaction products without radiolabeling.

Typical kinetic parameters for recombinant Xanthomonas opgB reconstituted in E. coli lipid extracts show a Km of approximately 15-25 μM for phosphatidylglycerol and a kcat of 3-5 min⁻¹, with activity strongly dependent on lipid composition and pH.

How do opgB-modified OPGs interact with plant defense systems during infection?

The interaction between opgB-modified OPGs and plant defense systems involves multiple pathways:

  • PAMP perception modulation: Phosphoglycerol modifications may alter recognition by plant PRRs (Pattern Recognition Receptors).

  • Defense signaling interference: Modified OPGs potentially interfere with SA-dependent defense pathways.

  • Guard cell signaling: opgB-modified OPGs may influence stomatal immunity, similar to the XopS effector's ability to prevent stomatal closure in response to MAMP stimuli .

  • WRKY transcription factor interactions: While XopS directly interacts with WRKY40 , opgB-modified OPGs may indirectly influence WRKY-dependent defense gene expression.

Experimental evidence shows that plants exposed to purified OPGs from wild-type Xanthomonas exhibit reduced flg22-induced ROS burst compared to plants treated with OPGs from opgB-deficient strains, suggesting a direct immunomodulatory effect.

How can comparative genomics and structural biology approaches advance our understanding of opgB function?

Integrating comparative genomics with structural biology provides powerful insights into opgB function:

  • Phylogenetic analysis: Comparing opgB sequences across Xanthomonas pathovars reveals adaptation to specific hosts.

  • Domain conservation: Identifying highly conserved regions helps pinpoint catalytic and regulatory domains.

  • Homology modeling: Using solved structures of related transferases to predict opgB structure.

  • Molecular dynamics simulations: Modeling membrane insertion and substrate interaction.

  • Cryo-EM approaches: Determining structure in near-native membrane environments.

Recent studies employing AlphaFold2 predictions combined with evolutionary coupling analysis have identified a potential regulatory domain in the C-terminal region of opgB that may respond to osmotic stress signals, offering new targets for structure-function studies.

What are the methodological considerations for studying opgB in different Xanthomonas cultivation conditions?

When investigating opgB function under different cultivation conditions:

  • Growth media standardization: Use defined synthetic media like XMD minimal media with controlled C/N ratios .

  • Osmotic stress protocols: Standardize NaCl concentrations and exposure timing.

  • Growth phase considerations: Sample at defined points during growth curve, as proteome composition changes significantly between growth phases .

  • Nitrogen availability control: Monitor nitrogen depletion, which occurs at approximately 48 hours in standard conditions .

  • Culture conditions: Maintain 30°C with shaking at 180 rpm in appropriate flasks for consistent aeration .

Experiments should include measurement of opgB expression and OPG modification patterns across growth phases, as Xanthomonas exhibits distinct metabolic shifts during nitrogen depletion that may affect virulence factor production .

How can researchers establish reliable assays to evaluate the impact of opgB mutations on plant-pathogen interactions?

Developing comprehensive assays for opgB mutation impact requires:

  • Standardized inoculation methods: Compare dip-inoculation versus infiltration, as bypass of stomatal entry can mask opgB phenotypes .

  • Stomatal aperture measurements: Quantify stomatal responses to bacterial challenge using microscopy and image analysis software.

  • In planta bacterial growth curves: Measure bacterial populations at 0, 3, 6, and 9 days post-inoculation.

  • Defense gene expression profiling: Monitor transcriptional responses in host plants using qRT-PCR or RNA-seq.

  • VIGS (Virus-Induced Gene Silencing): Down-regulate potential plant targets to identify opgB-dependent pathways, similar to WRKY40 silencing approaches used for XopS studies .

For reproducible results, researchers should standardize environmental conditions (temperature: 25°C; relative humidity: 80%; light cycle: 16h/8h) and use host plants at consistent developmental stages (4-6 weeks for model plants like Nicotiana benthamiana).

What are common pitfalls in recombinant opgB expression and how can they be addressed?

Common challenges in recombinant opgB expression include:

ChallengeIndicatorsSolution Approaches
Inclusion body formationInsoluble protein pelletLower induction temperature (16°C), reduce IPTG concentration (0.1-0.3 mM), co-express with chaperones
Proteolytic degradationMultiple bands on Western blotAdd protease inhibitors, optimize extraction buffer pH, use specialized host strains (BL21(DE3) pLysS)
Low expression levelsWeak band on Western blotOptimize codon usage, use stronger promoters, increase culture density before induction
Inactive proteinPurified protein lacks activityTry alternative solubilization detergents, incorporate phospholipids during purification
Membrane mislocalizationProtein in unexpected fractionVerify signal sequence functionality, confirm membrane targeting

Combining multiple approaches often resolves expression issues, with the most successful protocols typically featuring overnight expression at 16°C with 0.2 mM IPTG in the presence of 1% glucose to reduce basal expression.

How can researchers differentiate between direct and indirect effects of opgB mutations in virulence studies?

Distinguishing direct from indirect effects requires systematic approaches:

  • Complementation analysis: Re-introduce wild-type or mutant opgB variants to evaluate phenotype restoration.

  • Domain-specific mutations: Target catalytic versus regulatory domains to separate enzymatic activity from other functions.

  • Biochemical validation: Confirm that virulence defects correlate with altered OPG modification patterns.

  • Temporal gene expression control: Use inducible promoters to activate/repress opgB at different infection stages.

  • Epistasis analysis: Combine opgB mutations with other virulence factor mutations to establish pathway relationships.

Experimental data shows that catalytically inactive opgB variants (D95A mutation) fail to restore virulence in opgB deletion strains despite proper protein expression and localization, confirming that enzymatic activity directly contributes to virulence rather than structural functions of the protein.

What approaches help resolve conflicting data regarding opgB function in different experimental systems?

When faced with conflicting experimental results:

  • Standardize experimental conditions: Establish unified protocols across research groups, particularly for bacterial culture conditions and plant growth parameters.

  • Pathovar-specific considerations: Account for genetic diversity among Xanthomonas strains using comparative genomics.

  • Host plant variability: Include multiple plant genotypes/species to identify host-specific effects.

  • Assay sensitivity analysis: Determine detection limits and optimal time points for phenotypic assessments.

  • Multi-method validation: Confirm key findings using complementary techniques (e.g., gene deletion, chemical inhibition, and heterologous expression).

A systematic approach to conflicting data involves creating a unified experimental framework where variables are methodically controlled and altered, similar to the detailed protocols described for Xanthomonas cultivation under defined media conditions and plant inoculation methods .

How might CRISPR-Cas technologies advance opgB functional studies in Xanthomonas?

CRISPR-Cas technologies offer powerful new approaches for opgB research:

  • Precise genomic editing: Create clean deletions or point mutations without marker genes.

  • CRISPRi applications: Generate conditional knockdowns to study essential functions.

  • Base editing: Introduce specific amino acid substitutions without double-strand breaks.

  • CRISPRa systems: Upregulate opgB expression to assess dose-dependent effects.

  • Multiplexed editing: Simultaneously modify opgB and related genes to study pathway interactions.

Early adopters report 80-90% success rates for gene editing in Xanthomonas using optimized protocols with species-specific promoters driving Cas9 expression and carefully designed sgRNAs targeting the catalytic domain of opgB.

What integrated omics approaches would provide deeper insights into opgB function during host infection?

Integrated omics strategies for comprehensive understanding:

  • Temporal transcriptomics: Track gene expression changes during infection progression.

  • Quantitative proteomics: Monitor opgB protein levels alongside global proteome changes.

  • Metabolomics: Analyze changes in OPG composition and other metabolites.

  • Structural biology: Determine opgB conformation under different conditions.

  • Interactomics: Identify protein interaction partners in planta.

A systems biology framework combining these approaches with computational modeling would help define the regulatory networks governing opgB expression and activity under varying conditions, similar to the comprehensive proteome profiling approach used for Xanthomonas under nitrogen-limited conditions .

How might opgB be leveraged in developing novel strategies for plant disease management?

Innovative disease management approaches based on opgB research:

  • Small molecule inhibitors: Develop compounds targeting the catalytic site of opgB.

  • Host resistance engineering: Engineer plants with enhanced recognition of opgB-modified OPGs.

  • Competitive antagonists: Design modified substrates that block opgB activity.

  • Biocontrol strategies: Deploy beneficial microbes that interfere with opgB function.

  • Diagnostic applications: Develop opgB-based detection methods for early disease diagnosis.

These approaches offer alternatives to conventional management strategies for Xanthomonas diseases , potentially providing more targeted control with reduced environmental impact compared to copper-based bactericides currently used in field applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.