Recombinant Xanthomonas campestris pv. vesicatoria Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Undecaprenyl-diphosphatase (uppP), classified under EC 3.6.1.27, catalyzes the hydrolysis of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) and inorganic phosphate. This reaction is critical for recycling lipid carriers during bacterial cell wall synthesis . In Xanthomonas species, uppP is implicated in bacitracin resistance by maintaining the pool of UP, which is essential for transporting peptidoglycan precursors across the cytoplasmic membrane .

Key reaction:

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

The enzyme requires divalent cations like Ca²⁺ for optimal activity .

Pathogenicity and Research Applications

In X. campestris pv. vesicatoria, uppP’s role intersects with virulence mechanisms:

  • Cell wall integrity: Maintaining UP levels supports pathogen survival during plant infection .

  • Antibiotic resistance: Bacitracin interferes with UP recycling, making uppP a potential target for antimicrobial strategies .

Studies on HrpX-regulated genes in X. campestris pv. vesicatoria highlight the importance of hydrolases in plant-pathogen interactions, though uppP itself has not been directly linked to type III effector systems .

Comparative Analysis of Recombinant uppP Variants

Data from homologous systems reveal functional conservation:

FeatureX. campestris pv. campestris E. coli
TagUndetermined during productionN-terminal His tag
HostYeastE. coli
Activity EnhancementNot reportedCa²⁺/Mg²⁺ dependent

Research Gaps and Future Directions

No peer-reviewed studies explicitly describe the cloning, purification, or functional characterization of recombinant X. campestris pv. vesicatoria uppP. Priority areas include:

  • Structural resolution to guide inhibitor design.

  • Functional assays in vesicatoria’s infection models.

  • Comparative studies with homologs from other Xanthomonas pathovars .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery details.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
uppP; bacA; XCV0187; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
uppP
Target Protein Sequence
MSDLISALLLGILEGLTEFLPISSTGHLLIAEQWLGRRSDFFNIVIQAGAILAICLALRQ RLWSLATGLGERANRDYVLKVGVAFLVTAVVGLIVRKAGWQLPETLQPVAWALLIGGVWM LVAEHFAGKLPERDVVTWKVAIAVGLAQVVAGVFPGTSRSASTIFIAMLLGLSKRSAAAD FVFMVGIPTMFAASGYALLEMYKEGGFGTENWTDVAVAFVAATITGFVVVKWLLGYIKKH RFTVFAVYRMLLGAALLLWLPAAAG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: xcv:XCV0187

STRING: 316273.XCV0187

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in Xanthomonas campestris pv. vesicatoria?

Undecaprenyl-diphosphatase (uppP), also known as Bacitracin resistance protein or Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an enzyme found in Xanthomonas campestris pv. vesicatoria, the causal agent of bacterial spot disease in tomato and pepper plants. This enzyme plays a crucial role in bacterial cell wall peptidoglycan biosynthesis by recycling the lipid carrier undecaprenyl pyrophosphate. The protein is encoded by the uppP gene (synonym: bacA) with the ordered locus name XCV0187 in strain 85-10 .

The enzyme functions by hydrolyzing undecaprenyl pyrophosphate to undecaprenyl phosphate, which is then used as a carrier for cell wall precursors. This recycling process is essential for maintaining the pool of lipid carriers required for continuous cell wall synthesis and bacterial growth. Additionally, the enzyme contributes to resistance against antimicrobial compounds such as bacitracin that target the bacterial cell wall synthesis pathway .

How does Xanthomonas campestris pv. vesicatoria contribute to plant disease?

Xanthomonas campestris pv. vesicatoria is the causal agent of bacterial spot disease of tomato and pepper plants, a significant agricultural concern worldwide. The disease process is complex and involves numerous genes in both the pathogen and host . The bacterium enters plant tissues through natural openings or wounds and multiplies in the intercellular spaces, causing necrotic lesions on leaves, stems, and fruits.

The pathogenicity of X. campestris pv. vesicatoria depends on multiple factors, including:

  • Type III secretion system (T3SS) - delivers approximately 30 effector proteins into host cells

  • Effector proteins - suppress plant immune responses and alter host cellular processes

  • Cell wall-degrading enzymes - break down plant cell walls

  • Extracellular polysaccharides - protect bacteria from host defenses

  • Various metabolic and stress response genes - activated during host interaction

Research using recombinase-based in vivo expression technology (RIVET) has identified 61 unique genes or operons activated during the pathogen's interaction with tomato plants . Among identified virulence factors is the XopB effector, which suppresses plant defense responses by interfering with reactive oxygen species (ROS) production. Infection studies have shown that deletion of specific genes can reduce the pathogen's ability to grow in planta and cause disease symptoms .

What are the recommended storage and handling conditions for recombinant Xanthomonas campestris pv. vesicatoria uppP?

For optimal stability and activity of recombinant Xanthomonas campestris pv. vesicatoria uppP, the following storage and handling protocols are recommended:

Storage Conditions:

  • Long-term storage: -20°C to -80°C with 50% glycerol as a cryoprotectant

  • Shelf life: Approximately 6 months for liquid formulations at -20°C/-80°C and 12 months for lyophilized preparations at the same temperatures

  • Working aliquots: Store at 4°C for up to one week

Handling Recommendations:

  • Avoid repeated freeze-thaw cycles, which can degrade the protein

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Aliquot into small volumes for single use to minimize freeze-thaw cycles

These storage and handling conditions are critical for maintaining the structural integrity and enzymatic activity of the protein, especially since membrane proteins like uppP can be particularly sensitive to denaturation during freeze-thaw cycles.

What expression systems are most effective for producing recombinant Xanthomonas campestris pv. vesicatoria uppP?

The expression of recombinant Xanthomonas campestris pv. vesicatoria uppP presents challenges common to membrane proteins. Based on available research and product information, several expression systems have been successfully employed:

Expression Systems Comparison:

Expression SystemAdvantagesChallengesTypical YieldRecommended Applications
YeastPost-translational modifications, membrane protein folding capabilitySlower growth than bacteriaModerateStructural studies, functional assays
E. coliRapid growth, high yield potential, economicalPotential inclusion body formation, lack of post-translational modificationsVariable (depends on solubility)Immunogen production, antibody generation
Insect cellsEnhanced folding of complex proteins, post-translational modificationsHigher cost, more complex protocolsModerate to highStructural and functional studies requiring native conformation

For recombinant uppP from related Xanthomonas strains, yeast-based expression systems have been successfully employed . These systems provide a eukaryotic environment that can better facilitate proper folding of membrane proteins compared to bacterial expression systems.

To optimize expression, consider the following methodological approaches:

  • Use fusion tags (e.g., His, GST) to facilitate purification and potentially enhance solubility

  • Optimize codon usage for the chosen expression system

  • Employ specialized bacterial strains designed for membrane protein expression if using E. coli

  • Test expression at lower temperatures (16-25°C) to enhance proper folding

  • Consider using detergents or amphipols for extraction and stabilization during purification

How can the enzymatic activity of recombinant uppP be measured in laboratory settings?

Measuring the enzymatic activity of recombinant Xanthomonas campestris pv. vesicatoria uppP requires specialized assays that accommodate its membrane-associated nature and specific substrate requirements. Several methodological approaches can be employed:

1. Radiometric Assay:

  • Substrate: [14C]-labeled undecaprenyl pyrophosphate

  • Principle: Measure the release of inorganic [14C]phosphate

  • Detection: Liquid scintillation counting

  • Advantages: High sensitivity and specificity

2. Colorimetric Phosphate Release Assay:

  • Principle: Measure inorganic phosphate release using malachite green or other phosphate-binding dyes

  • Detection: Spectrophotometric measurement at specific wavelengths

  • Advantages: No radioactivity required, relatively simple setup

3. HPLC-based Assay:

  • Principle: Separate and quantify reaction products (undecaprenyl phosphate) from substrates

  • Detection: UV absorbance or mass spectrometry

  • Advantages: Direct quantification of product formation

4. Fluorescence-based Assay:

  • Substrate: Fluorescently labeled analogs of undecaprenyl pyrophosphate

  • Principle: Monitor changes in fluorescence upon dephosphorylation

  • Advantages: Real-time monitoring capability, high sensitivity

Methodological Considerations:

  • Ensure proper reconstitution of the membrane protein (detergent micelles, liposomes, or nanodiscs)

  • Control pH and temperature carefully (optimal conditions typically pH 7.0-8.0, 30-37°C)

  • Include appropriate controls (heat-inactivated enzyme, known inhibitors)

  • Validate assay specificity with structurally related substrates

  • Consider the effects of detergents or lipids on enzymatic activity

How does uppP contribute to Xanthomonas campestris pv. vesicatoria virulence and plant infection?

The uppP gene (bacA) has been studied in other bacterial pathogens where it contributes to:

  • Environmental Stress Resistance: The ability to withstand osmotic stress and host defense mechanisms

  • Antimicrobial Resistance: Protection against host-derived antimicrobial compounds

  • Cell Envelope Integrity: Maintenance of proper cell shape and protection against lysis

  • Biofilm Formation: Contribution to bacterial attachment and persistence on plant surfaces

Methodologically, to study the contribution of uppP to virulence, researchers could:

  • Generate uppP knockout mutants and assess their ability to grow in planta

  • Evaluate plant symptom development during infection with wild-type versus uppP-deficient strains

  • Measure bacterial resistance to plant-derived antimicrobial compounds

  • Analyze cell wall composition and integrity in uppP mutants during plant colonization

How does Xanthomonas campestris pv. vesicatoria suppress plant immune responses, and is uppP involved?

The XopB effector protein has been extensively characterized and provides a model for immune suppression mechanisms:

  • Inhibition of ROS Production: XopB interferes with the reactive oxygen species (ROS) burst, a key component of plant defense

  • Suppression of Salicylic Acid (SA) Accumulation: Plants infected with XopB-deficient strains show increased SA levels and pathogenesis-related (PR) gene expression

  • Interference with Callose Deposition: XopB reduces the plant's ability to reinforce cell walls through callose formation

  • Modulation of Defense Gene Expression: XopB affects the expression of defense-related genes, including those encoding apoplastic peroxidases and NADPH oxidase RBOHD

Research methodologies to investigate potential uppP involvement in immune suppression could include:

  • Transcriptome analysis comparing plant responses to wild-type and uppP-deficient bacteria

  • Measurement of key defense molecules (ROS, SA, callose) during infection with uppP mutants

  • Protein-protein interaction studies to identify potential uppP interactions with plant defense components

  • Expression analysis of uppP during different stages of infection to correlate with suppression events

What control strategies target Xanthomonas campestris pv. vesicatoria, and could uppP be a potential target?

Several control strategies have been developed to manage Xanthomonas campestris pv. vesicatoria infections in crops, and understanding the potential of uppP as a target requires evaluation within this context:

Current Control Strategies:

  • Bacteriophage-Based Biocontrol: Specific bacteriophages targeting X. campestris pv. vesicatoria have been developed as biopesticides (e.g., AgriPhage). These have been approved for commercial use on tomato and pepper plants and are considered non-toxic to humans .

  • Chemical Controls: Traditional copper-based bactericides and antibiotics

  • Resistant Plant Varieties: Development of tomato and pepper cultivars with resistance genes

  • Cultural Practices: Crop rotation, sanitation, and management of plant debris

uppP as a Potential Target:

uppP represents a potentially valuable target for antimicrobial development because:

  • It is essential for bacterial cell wall synthesis

  • It has a role in antimicrobial resistance (particularly to bacitracin)

  • It has no direct homolog in plants or humans

Methodological approaches to develop uppP-targeted controls:

  • Structure-Based Drug Design:

    • Determine the three-dimensional structure of uppP

    • Identify potential binding pockets for small molecule inhibitors

    • Use computational screening to identify candidate compounds

  • High-Throughput Screening:

    • Develop assays suitable for screening compound libraries

    • Focus on compounds that inhibit uppP activity but have minimal toxicity to plants

  • Peptide Inhibitors:

    • Design antimicrobial peptides that specifically target uppP function

    • Evaluate their efficacy in controlled greenhouse studies

  • CRISPR-Based Antimicrobials:

    • Develop CRISPR-Cas systems targeted to the uppP gene

    • Delivery via bacteriophage vectors specific to X. campestris pv. vesicatoria

A targeted approach against uppP would need to be evaluated for efficacy against the bacterium while ensuring safety for plants, beneficial microorganisms, and consumers.

What structural features of uppP are critical for its enzymatic function, and how can they be studied?

Understanding the structure-function relationship of Xanthomonas campestris pv. vesicatoria uppP is essential for characterizing its enzymatic mechanism. While the specific structural features of this particular uppP are not directly described in the search results, we can infer critical features based on homologous enzymes and provide methodological approaches for their study.

Critical Structural Features:

  • Transmembrane Domains: uppP typically contains multiple transmembrane helices that anchor it in the bacterial membrane, positioning the active site to access its lipid substrate

  • Catalytic Residues: Conserved amino acids (often including aspartic acid residues) that coordinate with magnesium ions and participate directly in the dephosphorylation reaction

  • Substrate Binding Pocket: Hydrophobic regions that accommodate the undecaprenyl moiety along with positively charged residues that interact with the pyrophosphate group

  • Conformational Flexibility: Regions that undergo structural changes during the catalytic cycle to facilitate substrate binding and product release

Methodological Approaches for Structural Studies:

MethodInformation ProvidedTechnical ConsiderationsResolution
X-ray CrystallographyHigh-resolution 3D structureRequires crystal formation, challenging for membrane proteins1.5-3.0 Å
Cryo-Electron Microscopy3D structure, conformational statesSample preparation critical, works well for membrane proteins2.5-4.0 Å
NMR SpectroscopyDynamic information, solution structureSize limitations, requires isotope labelingAtomic-level
Molecular Dynamics SimulationConformational changes, substrate interactionsRequires initial structural model, computational intensityDependent on model
Site-Directed MutagenesisFunctional importance of specific residuesCombined with activity assaysResidue-level
Hydrogen-Deuterium Exchange MSProtein dynamics, solvent accessibilityCan be applied to membrane proteinsPeptide-level

For uppP specifically, researchers should consider:

  • Reconstitution in membrane mimetics (nanodiscs, detergent micelles) for structural studies

  • Combining computational approaches with experimental validation

  • Comparative analysis with structurally characterized homologs

  • Identification of conserved residues across bacterial species for targeted mutagenesis

How does the substrate specificity of Xanthomonas campestris pv. vesicatoria uppP compare to homologs from other bacterial species?

While specific data on the substrate specificity of Xanthomonas campestris pv. vesicatoria uppP is not provided in the search results, a comparative analysis methodology can be outlined based on information about homologous enzymes:

Methodology for Substrate Specificity Analysis:

  • Sequence Alignment and Phylogenetic Analysis:

    • Align uppP sequences from diverse bacterial species including Xanthomonas, E. coli, Bacillus, and Pseudomonas

    • Identify conserved and variable regions that might contribute to substrate recognition

    • Construct phylogenetic trees to visualize evolutionary relationships

  • Homology Modeling:

    • Generate structural models of X. campestris pv. vesicatoria uppP based on crystallized homologs

    • Compare substrate binding pockets and catalytic sites

  • Recombinant Protein Expression and Purification:

    • Express uppP from X. campestris pv. vesicatoria and selected bacterial species

    • Purify proteins using similar methods to ensure comparable results

  • Comparative Biochemical Characterization:

    • Test activity against:

      • Natural substrate (undecaprenyl pyrophosphate)

      • Substrate analogs with varying lipid chain lengths (C5-C55)

      • Substrate analogs with modified head groups

    • Determine kinetic parameters (Km, Vmax, kcat) for each substrate

    • Compare pH and temperature optima across homologs

  • Inhibitor Profiling:

    • Test sensitivity to known phosphatase inhibitors

    • Evaluate species-specific differences in inhibition patterns

  • Chimeric Protein Analysis:

    • Create chimeric proteins exchanging domains between uppP homologs

    • Determine which regions confer substrate specificity differences

Expected Differences in Substrate Specificity:

Based on bacterial membrane composition differences, we might expect variations in:

  • Preference for different isoprenoid chain lengths

  • Tolerance for substrate analogs

  • Affinity for the pyrophosphate moiety

  • Dependence on specific lipid environments for optimal activity

These differences could be exploited for the development of species-specific inhibitors targeting Xanthomonas campestris pv. vesicatoria without affecting beneficial bacteria.

What are the key differences between recombinant uppP and native bacterial uppP in terms of structure and function?

Understanding the differences between recombinant and native uppP is crucial for interpreting experimental results and ensuring that findings from recombinant systems accurately reflect natural bacterial processes. While specific comparative data for X. campestris pv. vesicatoria uppP is not provided in the search results, we can outline potential differences and methodological approaches for their assessment:

Potential Differences Between Recombinant and Native uppP:

  • Post-translational Modifications:

    • Native bacterial uppP may undergo modifications not replicated in recombinant systems

    • Methodological approach: Mass spectrometry analysis of native protein extracted from X. campestris pv. vesicatoria compared to recombinant versions

  • Protein Folding and Conformation:

    • Expression environment may affect protein folding, especially for membrane proteins

    • Methodological approach: Circular dichroism spectroscopy to compare secondary structure elements

  • Membrane Environment:

    • Native uppP functions in bacterial membranes with specific lipid compositions

    • Recombinant uppP is often studied in detergent micelles or artificial membranes

    • Methodological approach: Activity assays in various membrane mimetics compared to native membrane extracts

  • Protein-Protein Interactions:

    • Native uppP may participate in protein complexes within the bacterial membrane

    • Methodological approach: Crosslinking studies, co-immunoprecipitation, or blue native PAGE of bacterial membranes

  • Enzymatic Parameters:

    • Catalytic efficiency may differ between recombinant and native forms

    • Methodological approach: Detailed kinetic analysis of enzyme prepared from both sources

Research Strategy for Comparative Analysis:

  • Extract native uppP from X. campestris pv. vesicatoria membranes using gentle solubilization techniques

  • Purify the native protein using affinity chromatography with uppP-specific antibodies

  • Express recombinant uppP in different systems (E. coli, yeast, insect cells)

  • Compare biochemical properties using identical assay conditions

  • Evaluate structural properties using biophysical techniques

  • Assess functional complementation by introducing recombinant uppP into uppP-deficient bacteria

This comparative approach would provide valuable insights into how accurately recombinant systems model the native bacterial enzyme and identify any modifications needed to improve experimental models.

How can recombinant Xanthomonas campestris pv. vesicatoria uppP be used in antimicrobial resistance studies?

Recombinant Xanthomonas campestris pv. vesicatoria uppP offers valuable opportunities for antimicrobial resistance research, particularly since its alternative name, "Bacitracin resistance protein," highlights its role in antibiotic resistance . While specific applications are not directly detailed in the search results, the following methodological approaches would be valuable:

Research Applications in Antimicrobial Resistance:

  • Inhibitor Discovery and Characterization:

    • High-throughput screening of chemical libraries against purified recombinant uppP

    • Structure-activity relationship studies of identified inhibitors

    • In silico docking studies to identify potential binding sites

    Methodological approach: Develop a fluorescence-based assay suitable for 96 or 384-well format screening, followed by secondary validation assays and structural studies of enzyme-inhibitor complexes.

  • Resistance Mechanism Elucidation:

    • Site-directed mutagenesis to create variants mimicking naturally occurring resistance mutations

    • Characterization of mutant enzymes' catalytic properties and inhibitor sensitivity

    Methodological approach: Generate a panel of uppP variants with systematic amino acid substitutions, determine their kinetic parameters, and evaluate their sensitivity to various inhibitors.

  • Cross-Resistance Profiling:

    • Comparative analysis of uppP from different bacterial species

    • Evaluation of species-specific differences in inhibitor sensitivity

    Methodological approach: Express and purify uppP from multiple plant pathogens and human pathogens, then compare their biochemical properties and response to inhibitors.

  • Development of Diagnostic Tools:

    • Creation of antibodies or aptamers specific to Xanthomonas uppP

    • Development of diagnostic assays for specific detection of resistant bacteria

    Methodological approach: Use purified recombinant uppP as an immunogen for antibody production or as a target for aptamer selection.

  • Combination Therapy Evaluation:

    • Testing uppP inhibitors in combination with other antimicrobials

    • Assessment of synergistic effects

    Methodological approach: Use checkerboard assays with uppP inhibitors and conventional antibiotics, followed by time-kill studies to confirm synergistic combinations.

These research applications could contribute to addressing the growing concern of antimicrobial resistance in both agricultural and clinical settings.

What biotechnological applications might utilize recombinant Xanthomonas campestris pv. vesicatoria uppP?

Beyond its role in antimicrobial resistance research, recombinant Xanthomonas campestris pv. vesicatoria uppP has potential applications in various biotechnological contexts:

1. Biosensor Development:

  • Application: Detection of specific phosphatase inhibitors or environmental pollutants

  • Methodological approach: Immobilize purified uppP on biosensor surfaces and measure activity changes upon exposure to test samples

  • Advantages: Bacterial phosphatases can be more stable than eukaryotic enzymes in biosensor applications

2. Enzymatic Synthesis of Specialized Lipids:

  • Application: Production of modified undecaprenyl phosphate derivatives for glycosylation reactions

  • Methodological approach: Use uppP in reverse reactions with appropriate cofactors to generate phospholipid products

  • Advantages: Enzymatic synthesis can provide stereospecific products difficult to achieve through chemical synthesis

3. Protein Engineering Platform:

  • Application: Development of membrane protein engineering techniques

  • Methodological approach: Use uppP as a model system for directed evolution of membrane proteins

  • Advantages: Insights gained could apply to other challenging membrane protein targets

4. Vaccine Development:

  • Application: Creation of attenuated Xanthomonas strains for plant vaccination

  • Methodological approach: Engineer strains with modified uppP activity that maintain immunogenicity but reduced virulence

  • Advantages: Plant immune priming without disease risk

5. Biocatalysis in Organic Solvents:

  • Application: Phosphate group modifications in non-aqueous environments

  • Methodological approach: Stabilize uppP in organic solvents through protein engineering or immobilization

  • Advantages: Access to reactions not feasible in aqueous environments

6. Plant Protection Technologies:

  • Application: Development of transgenic plants expressing uppP inhibitors

  • Methodological approach: Identify plant-compatible inhibitors and optimize expression in crop species

  • Advantages: Targeted protection against Xanthomonas without broad-spectrum antimicrobials

Each of these applications would require optimization of recombinant uppP production and characterization, followed by application-specific development and validation.

How might gene editing technologies be applied to study uppP function in Xanthomonas campestris pv. vesicatoria?

Gene editing technologies provide powerful tools for investigating uppP function in Xanthomonas campestris pv. vesicatoria. While specific examples are not provided in the search results, the following methodological approaches would be valuable for researchers:

CRISPR-Cas9 Applications:

  • Gene Knockout Studies:

    • Complete deletion of the uppP gene to assess essentiality

    • Creation of conditional knockouts if uppP is essential

    Methodological approach: Design sgRNAs targeting the uppP coding sequence, introduce CRISPR-Cas9 components via electroporation, and select for successful editing events. For conditional knockdowns, place uppP under an inducible promoter.

  • Point Mutation Introduction:

    • Creation of specific mutations in catalytic residues

    • Introduction of mutations observed in resistant strains

    Methodological approach: Use CRISPR-Cas9 with a repair template containing the desired mutation, followed by phenotypic and biochemical characterization.

  • Domain Swapping:

    • Replace domains with counterparts from other bacterial species

    • Create chimeric proteins to assess domain function

    Methodological approach: Design CRISPR strategies that facilitate precise replacement of coding sequences for specific domains.

  • Promoter Modifications:

    • Alter uppP expression levels to assess dosage effects

    • Create reporter fusions to study expression patterns

    Methodological approach: Target CRISPR-Cas9 to the promoter region and introduce modified promoter sequences or reporter gene fusions.

  • Tagged Protein Expression:

    • Introduction of epitope or fluorescent tags for localization studies

    • Addition of affinity tags for protein complex isolation

    Methodological approach: Use CRISPR-Cas9 to introduce tag-encoding sequences at the genomic locus.

Comparative Gene Editing Approaches:

TechniqueAdvantagesLimitationsBest Applications
CRISPR-Cas9Precise editing, multiplexing capabilityPAM site requirements, off-target effectsGene knockouts, point mutations
CRISPR-Cas12aT-rich PAM sites, staggered cutsLower editing efficiency in some casesAT-rich target regions
Base EditorsNo DSB required, high efficiencyLimited to certain substitutionsSingle nucleotide changes
Prime EditingPrecise edits without DSB, flexibleLower efficiency, technical complexitySmall insertions/deletions, point mutations
Homologous RecombinationWell-established in XanthomonasLower efficiency, selection markers neededLarge modifications, gene replacements

Phenotypic Analyses Following Gene Editing:

  • Growth rate measurements under various conditions

  • Antimicrobial susceptibility testing

  • In planta virulence assays

  • Cell morphology examination

  • Lipidomic analysis of membrane composition

These approaches would provide comprehensive insights into uppP function in Xanthomonas campestris pv. vesicatoria and contribute to our understanding of its role in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.