Recombinant Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198 (XCV3198)

Shipped with Ice Packs
In Stock

Description

General Information

CategoryDescription
NameRecombinant Full Length Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198(XCV3198) Protein, His-Tagged
SourceE. coli
TagHis
Protein LengthFull Length (1-111)
FormLyophilized powder
Amino Acid SequenceMTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSMWLLLPTALSLAVFVWLLSLHPEASGRVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDQ3BQN4
SynonymsXCV3198; UPF0060 membrane protein XCV3198

Structure and Function

The protein's amino acid sequence includes an N-terminal signal sequence and is rich in beta-sheet stretches . Beta sheets are stabilized by hydrogen bonds and can exist in parallel or anti-parallel configurations . The hrpA expression is independent of the hrpX regulatory gene, and the HrpA1 protein is localized in the outer membrane of X. campestris pv. vesicatoria .

Secretion and Virulence

Xanthomonas campestris pv. vesicatoria uses a type II secretion (T2S) system to secrete degradative enzymes . These enzymes degrade plant cell walls during host-pathogen interactions, promoting bacterial virulence . In X. campestris pv. vesicatoria, secretion of T2S substrates was not completely absent in T2S mutants, suggesting the contribution of additional transport systems to protein secretion . T2S substrates were detected in outer membrane vesicles, suggesting that extracellular virulence-associated enzymes from X. campestris pv. vesicatoria are targeted to the Xps-T2S system and to outer membrane vesicles . Outer membrane vesicles (OMVs) released from the outer membrane of X. campestris pv. campestris contain membrane- and virulence-associated proteins .

Experimental Methods

The following table summarizes methods for the expression, purification, and characterization of Recombinant Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198.

MethodDescription
ExpressionRecombinant Full Length Xanthomonas campestris pv. vesicatoria UPF0060 membrane protein XCV3198(XCV3198) Protein (Q3BQN4) (1-111aa), fused to N-terminal His tag, was expressed in E. coli .
Purity CheckGreater than 90% as determined by SDS-PAGE .
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
ReconstitutionBriefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. The default final concentration of glycerol is 50% .
Cell fractionation studiesCell fractionation studies demonstrated that the HrpA1 protein is localized in the outer membrane of X. campestris pv. vesicatoria .

Guidelines for data presentation

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small space To show trends, patterns, and relationships across and between datasets When you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variables To summarize research results When putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristics To present a visual explanation of a sequence of events, procedures, or characteristics When the data that you are planning to present is irrelevant to the main study findings .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
XCV3198; UPF0060 membrane protein XCV3198
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Target Names
XCV3198
Target Protein Sequence
MTIAPTTLLLFAATALAELVGCYLPYLWLRKGGSMWLLLPTALSLAVFVWLLSLHPEASG RVYAAYGGVYIASALLWLWWVDGVTPTRWDLLGAACCLLGMAVIMFSPRSA
Uniprot No.

Target Background

Database Links

KEGG: xcv:XCV3198

STRING: 316273.XCV3198

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is XCV3198 and what is its relevance in research?

XCV3198 is a UPF0060 family membrane protein from the plant pathogen Xanthomonas campestris pv. vesicatoria (strain 85-10). This protein consists of 111 amino acids and is classified as a membrane protein with potential significance in bacterial physiology . The UPF0060 designation indicates it belongs to a family of proteins with unknown function, making it an interesting target for fundamental research into bacterial membrane protein structure and function. As part of the Xanthomonas genus, which contains several important plant pathogens, understanding this protein may provide insights into bacterial pathogenicity mechanisms and potential targets for disease control in agricultural settings.

What are the optimal storage conditions for recombinant XCV3198?

For optimal preservation of recombinant XCV3198, the protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been specifically optimized for this protein . For extended storage periods, maintaining the protein at -20°C or preferably -80°C is recommended. It's important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of structural integrity. For working experiments lasting up to one week, aliquots can be safely stored at 4°C . This storage protocol helps maintain protein stability by preventing denaturation and protease-mediated degradation.

Storage PurposeTemperatureMaximum DurationBuffer Composition
Standard storage-20°CMonthsTris-based buffer, 50% glycerol
Long-term storage-80°CYearsTris-based buffer, 50% glycerol
Working aliquots4°CUp to one weekTris-based buffer, 50% glycerol

What expression systems are most effective for producing recombinant XCV3198?

The optimal expression system for recombinant XCV3198 depends on research objectives and required protein characteristics. For membrane proteins like XCV3198, several expression systems can be considered:

  • Prokaryotic expression systems: While E. coli remains the most widely used host for protein expression, membrane proteins often present challenges in these systems. When using E. coli for XCV3198 expression, codon optimization is essential to address potential rare codon usage issues that might impede translation . Additionally, fusion tags (such as His-tags) at both N- and C-termini can help identify full-length proteins from truncated products during purification .

  • Eukaryotic expression systems: For more complex structural studies requiring post-translational modifications, yeast (e.g., Pichia pastoris) or insect cell systems may provide better results for membrane proteins like XCV3198.

  • Cell-free expression systems: These can circumvent toxicity issues sometimes associated with membrane protein overexpression and allow for direct incorporation into artificial membrane environments.

The selection of the appropriate expression system should be guided by specific experimental requirements, including protein yield needs, downstream applications, and structural integrity considerations.

How can we optimize solubilization and purification protocols for XCV3198?

Effective solubilization and purification of membrane proteins like XCV3198 require specialized approaches:

  • Membrane isolation: Begin with careful isolation of bacterial membranes containing the expressed XCV3198 protein. Differential centrifugation followed by sucrose gradient ultracentrifugation can effectively separate different membrane fractions.

  • Detergent screening: Conduct a systematic screening of multiple detergents to identify optimal solubilization conditions. Consider testing:

    • Mild detergents (DDM, LMNG)

    • Zwitterionic detergents (CHAPS, Fos-choline)

    • Nonionic detergents (Triton X-100)

  • Purification strategy: Implement a multi-step purification approach:

    • Initial affinity chromatography (using appropriate tags)

    • Size exclusion chromatography for further purification and buffer exchange

    • Optional ion exchange chromatography for removing specific contaminants

  • Quality assessment: Evaluate protein purity using SDS-PAGE and Western blotting, and assess structural integrity through circular dichroism or limited proteolysis experiments.

For XCV3198 specifically, using a stepwise imidazole gradient during elution can help distinguish full-length protein from truncated products, which is particularly important given the challenges associated with membrane protein expression .

What methodologies are recommended for structural characterization of XCV3198?

Structural characterization of membrane proteins like XCV3198 typically requires a multi-technique approach:

  • X-ray crystallography: While challenging for membrane proteins, this remains the gold standard for high-resolution structural determination. For XCV3198, crystallization trials should include:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle-based crystallization

    • Detergent screening optimization

    • Use of crystallization chaperones or antibody fragments

  • Cryo-electron microscopy (cryo-EM): Increasingly utilized for membrane protein structure determination, especially for those resistant to crystallization. For XCV3198, consider:

    • Reconstitution in nanodiscs or amphipols

    • Negative staining as an initial assessment

    • Optimization of vitrification conditions

  • Nuclear Magnetic Resonance (NMR): Suitable for dynamic studies and smaller membrane proteins:

    • Isotopic labeling (13C, 15N) of XCV3198

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for membrane-embedded states

  • Computational approaches: Modern deep learning methods like AlphaFold2 can provide accurate structural predictions for membrane proteins, serving as valuable starting models . For XCV3198, these predictions should be experimentally validated using the techniques described above.

Each approach has distinct advantages and limitations, and researchers should select methods based on available resources and specific research questions.

How can we design soluble analogues of XCV3198 while maintaining its structural features?

Recent advances in computational protein design have made it possible to create soluble analogues of membrane proteins that preserve their core structural features. For XCV3198, the following methodology can be implemented:

  • Computational design pipeline: Utilize deep learning approaches to design soluble versions of XCV3198 that maintain its topological features . This involves:

    • Identifying core structural elements to preserve

    • Redesigning hydrophobic surface residues to increase solubility

    • Introducing stabilizing interactions (salt bridges, hydrogen bonds)

    • Maintaining native-like fold through backbone constraints

  • Iterative design and experimental validation: The computational design process should be iterative, with experimental feedback guiding subsequent design rounds:

    • Express initial designs and assess solubility and structural integrity

    • Perform biophysical analyses to evaluate thermal stability

    • Obtain experimental structures to validate design accuracy

    • Refine designs based on experimental results

  • Functionality transfer: Once stable soluble analogues are obtained, native functional motifs from XCV3198 can be grafted onto the soluble scaffold:

    • Identify putative functional regions through conservation analysis

    • Engineer these motifs into the soluble analogue

    • Validate functional transfer through appropriate assays

This approach has proven successful for complex membrane protein topologies, including GPCRs, and could potentially enable new approaches to studying XCV3198 structure and function without the complications inherent to membrane protein biochemistry .

What computational methods are most effective for predicting XCV3198 interactions with other proteins and ligands?

Predicting interactions between XCV3198 and other biomolecules requires sophisticated computational approaches:

  • Protein-protein interaction prediction:

    • Sequence-based methods: Analysis of co-evolution patterns between XCV3198 and potential partner proteins

    • Structure-based docking: Using predicted or experimental structures to model interactions

    • Machine learning approaches: Employing trained algorithms that integrate multiple features to predict interaction likelihood

  • Ligand binding site prediction:

    • Cavity detection algorithms to identify potential binding pockets

    • Fragment-based approaches to identify favorable binding regions

    • Molecular dynamics simulations to map transient binding sites

  • Molecular dynamics simulations:

    • Membrane-embedded simulations to study XCV3198 dynamics

    • Potential of mean force calculations to estimate binding energetics

    • Enhanced sampling techniques to observe rare binding/unbinding events

  • Integrative modeling:

    • Combining experimental data (e.g., cross-linking, HDX-MS) with computational predictions

    • Network analysis to place XCV3198 in the context of broader interaction networks

    • Functional analysis based on predicted interactors

These computational approaches should be validated through targeted experimental studies, such as co-immunoprecipitation, surface plasmon resonance, or FRET-based interaction assays.

What role might XCV3198 play in bacterial pathogenicity mechanisms?

Understanding the potential role of XCV3198 in pathogenicity requires integrative approaches:

  • Comparative genomics:

    • Analyze the conservation of XCV3198 across Xanthomonas species and strains

    • Compare sequences between pathogenic and non-pathogenic strains

    • Identify genetic linkage with known virulence factors

  • Gene knockout studies:

    • Create XCV3198 deletion mutants using CRISPR-Cas9 or traditional methods

    • Assess changes in bacterial virulence in plant infection models

    • Perform complementation studies to confirm phenotype specificity

  • Transcriptomic and proteomic analysis:

    • Analyze expression changes under infection-relevant conditions

    • Determine if XCV3198 is co-regulated with known virulence factors

    • Identify potential regulatory elements controlling XCV3198 expression

  • Localization studies:

    • Determine subcellular localization during infection

    • Assess whether XCV3198 is secreted or remains membrane-bound

    • Investigate temporal changes in localization during infection progression

While the exact function of XCV3198 remains unknown (as indicated by the UPF0060 designation), its membrane localization suggests potential roles in processes relevant to pathogenicity, such as nutrient acquisition, stress response, or host interaction.

How can we integrate multiple structural prediction methods to obtain a reliable model of XCV3198?

Obtaining a reliable structural model of XCV3198 requires integrating predictions from multiple methods:

  • Ensemble approach to structure prediction:

    • Generate models using complementary methods (AlphaFold2, RoseTTAFold, SWISS-MODEL)

    • Assess model quality using metrics like pLDDT, PAE, and QMEANDisCo

    • Create a consensus model that integrates predictions from different methods

    • Identify regions of high confidence versus those requiring experimental validation

  • Refinement of predicted structures:

    • Energy minimization to resolve steric clashes

    • Membrane-embedded molecular dynamics simulations

    • Incorporation of experimental constraints when available

  • Validation against experimental data:

    • Cross-validate with limited proteolysis data

    • Compare with spectroscopic measurements (CD, FTIR)

    • Validate transmembrane topology predictions with experimental approaches

  • Handling prediction discrepancies:

    • For regions with inconsistent predictions, analyze the underlying causes

    • Consider alternative conformational states that might explain differences

    • Design targeted experiments to resolve structural ambiguities

An integrated approach accounts for the strengths and limitations of different prediction methods, leading to more reliable structural models that can guide experimental design and interpretation.

What statistical approaches are most appropriate for analyzing mutagenesis data for XCV3198?

Analyzing mutagenesis data for XCV3198 requires rigorous statistical approaches:

  • Experimental design considerations:

    • Ensure sufficient replication (minimum triplicate measurements)

    • Include appropriate positive and negative controls

    • Implement randomization to minimize batch effects

    • Consider factorial designs to evaluate interaction effects

  • Statistical analysis methods:

    • For comparing wild-type vs. mutant: t-tests with multiple testing correction

    • For analysis across multiple mutants: ANOVA with post-hoc tests

    • For complex phenotypes: multivariate analysis methods

    • For enrichment/depletion studies: specialized methods like GSEA

  • Regression and correlation analysis:

    • Correlate phenotypic effects with biophysical parameters

    • Develop predictive models for mutational outcomes

    • Identify patterns of epistasis through interaction term analysis

  • Visualization approaches:

    • Heat maps for representing mutational scanning data

    • Structure-based visualization of mutational effects

    • Network representations for epistatic interactions

For XCV3198 specifically, statistical power calculations should account for the typically higher variability observed in membrane protein experiments compared to soluble proteins.

How can we utilize XCV3198 as a model system for studying membrane protein biogenesis?

XCV3198 offers several advantages as a model system for studying fundamental aspects of membrane protein biogenesis:

  • Insertion and folding studies:

    • Use in vitro translation systems to study co-translational membrane insertion

    • Monitor folding kinetics using engineered fluorescent or luminescent reporters

    • Analyze the role of membrane composition on insertion efficiency and folding

  • Interaction with insertion machinery:

    • Investigate interactions with SecYEG/SecA or YidC insertion pathways

    • Determine the role of signal recognition particle (SRP) in targeting

    • Characterize interactions with membrane-associated chaperones

  • Topology determination methodology development:

    • Use XCV3198 as a test case for developing improved topology mapping techniques

    • Compare results from different experimental approaches (fusion reporters, chemical labeling)

    • Validate computational topology prediction algorithms

  • Post-insertion quality control:

    • Study recognition and degradation of misfolded variants

    • Investigate membrane protein turnover mechanisms

    • Analyze stress response activation by misfolded XCV3198

The relatively small size of XCV3198 (111 amino acids) makes it amenable to comprehensive mutational analysis and simplified structural studies, providing advantages over larger, more complex membrane proteins for certain fundamental questions.

What potential biotechnological applications might emerge from studying XCV3198?

Research on XCV3198 could lead to several biotechnological applications:

  • Membrane protein engineering platform:

    • Develop XCV3198 as a scaffold for designing novel membrane proteins

    • Create biosensors by engineering ligand-binding domains into XCV3198

    • Design membrane-anchored enzymes for biotransformation applications

  • Antimicrobial development:

    • If XCV3198 proves essential for Xanthomonas survival or virulence, it could become a target for developing antimicrobials

    • Design inhibitors that specifically target XCV3198 structure or function

    • Develop peptides that disrupt XCV3198 interactions with essential partners

  • Membrane protein expression technology:

    • Identify sequence elements that promote efficient membrane integration

    • Develop fusion constructs that enhance membrane protein expression

    • Create optimized signal sequences for industrial membrane protein production

  • Plant disease management:

    • If XCV3198 is involved in pathogenicity, develop strategies to block its function

    • Create diagnostic tools based on XCV3198 detection

    • Develop resistant crop varieties targeting XCV3198-mediated processes

While these applications require further characterization of XCV3198 function, they represent potential translational outputs from fundamental research on this membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.