Recombinant Xanthomonas oryzae pv. oryzae Large-conductance mechanosensitive channel (mscL)

What is the structure and function of the MscL channel in Xanthomonas oryzae pv. oryzae?

MscL (Large-conductance mechanosensitive channel) in Xanthomonas oryzae pv. oryzae functions as an osmoprotective emergency valve that opens a large water-filled pore in response to changes in membrane tension. The channel is a homopentamer consisting of 140 amino acids per monomer with specific domains including transmembrane regions and cytoplasmic termini . In its closed configuration, the last 36 residues at the C-terminus form a bundle of five α-helices co-linear with the five-fold axis of symmetry . The amino acid sequence of the full-length protein is MGMVSEFKQFAIRGNVIDLAVGVVIGAAFGKIVTALVEKIIMPPIGWAIGNVDFSRLAWVLKPAGVDATGKDIPAVAIGYGDFINTVVQFVIIAFAIFLLVKLINRVTNRKPDAPKGPSEEVLLLREIRDSLKNDTLKSG .

How are recombinant MscL proteins from Xanthomonas oryzae pv. oryzae typically produced?

Recombinant MscL proteins from Xanthomonas oryzae pv. oryzae are typically produced using E. coli expression systems with N-terminal His-tags for purification purposes. The general methodology involves:

• Gene cloning: The full-length mscL gene (coding for 1-140 amino acids) is amplified and cloned into a suitable expression vector.

• Transformation: The construct is transformed into E. coli host cells.

• Expression: Induction of protein expression under optimized conditions.

• Purification: Affinity chromatography using the His-tag.

• Product formulation: The purified protein is typically prepared as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol addition for long-term storage at -20°C/-80°C .

What experimental techniques are commonly used to study MscL channel function?

Several experimental techniques are employed to study MscL channel function:

How does the C-terminal domain of MscL contribute to channel gating mechanisms?

The C-terminal domain of MscL plays a crucial role in channel gating through a partial dissociation mechanism. According to experimental evidence combining SDSL EPR spectroscopy with computational modeling:

• Only the top portion of the C-terminal domain (residues A110 to E118) dissociates during channel gating.

• The lower portion remains assembled, maintaining the pentameric structure.

• This partial dissociation supports the hypothesis that the C-terminus functions both as a molecular sieve and as a stabilizer of the oligomeric MscL structure .

The experimental approach to elucidate this mechanism involved site-specific spin labeling of residues throughout the C-terminal domain, followed by EPR spectroscopy measurements in different membrane environments to mimic various states of membrane tension. Molecular dynamics simulations further validated these findings by showing the energetic favorability of this partial dissociation model over complete bundle disassembly .

What is the relationship between MscL channel abundance and bacterial survival during osmotic stress?

The relationship between MscL channel abundance and bacterial survival during osmotic stress is complex and not fully understood. Key research findings include:

For researchers investigating this relationship, combining superresolution microscopy to count channels with microfluidic devices that enable single-cell tracking during osmotic shock represents a promising methodological approach.

How do environmental factors influence MscL expression in Xanthomonas oryzae pv. oryzae?

MscL expression in Xanthomonas oryzae pv. oryzae appears to be condition-dependent, with several environmental factors influencing expression levels:

• Growth phase: Expression profiles change as bacteria transition through different growth stages.

• Carbon source availability: Different carbon nutrients affect MscL expression levels.

• Environmental stressors: Various challenges modify channel expression .

The regulatory mechanisms controlling this variable expression remain poorly understood. Researchers investigating these mechanisms should consider:

• Using quantitative transcriptomics (RNA-seq) to measure mscL transcript levels under various conditions.

• Employing reporter systems (e.g., mscL-sfGFP fusions) to track expression at the single-cell level.

• Analyzing promoter regions to identify potential regulatory elements.

• Investigating potential sRNA regulation similar to mechanisms identified for other genes in Xanthomonas oryzae pv. oryzae .

This variable expression pattern may explain why bacteria maintain more MscL channels than theoretically needed for basic osmotic protection, suggesting additional functions or regulatory complexity.

What are the optimal experimental designs for testing MscL channel function in vitro?

When designing experiments to test MscL channel function in vitro, researchers should consider the following methodological approaches:

• Patch-clamp electrophysiology:

  • Use inside-out or outside-out configurations to directly measure single-channel currents

  • Apply precisely controlled negative pressure to membrane patches

  • Record at different membrane potentials to characterize voltage dependence

  • Use symmetric and asymmetric ion concentrations to determine ion selectivity

• Reconstitution in liposomes:

  • Incorporate purified recombinant MscL at defined protein-to-lipid ratios

  • Use fluorescent dyes to measure solute efflux upon osmotic downshift

  • Manipulate lipid composition to test membrane environment effects

  • Apply controlled tension using osmotic gradients or micropipette aspiration

• Experimental controls:

  • Include known MscL mutants with altered gating thresholds as references

  • Compare wild-type and mutant channels side-by-side

  • Use multiple independent protein preparations to ensure reproducibility

  • Test channel function across a range of temperatures and pH values

• Data analysis considerations:

  • Apply appropriate statistical methods depending on experimental design (independent measures, repeated measures, or matched pairs designs)

  • Account for batch effects in protein preparation

  • Use appropriate models to fit channel opening kinetics

  • Consider both population-level and single-channel analyses

How can researchers distinguish between functional and non-functional recombinant MscL proteins?

Distinguishing between functional and non-functional recombinant MscL proteins requires a multi-faceted approach:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

  • Size-exclusion chromatography to verify pentameric assembly

  • Negative stain electron microscopy to visualize channel complexes

  • SDS-PAGE to assess purity (>90% as standard for functional studies)

• Functional assays:

  • Electrophysiological recordings to demonstrate pressure-sensitive gating

  • Fluorescence-based liposome swelling/shrinking assays

  • In vivo complementation of MscL-deficient bacterial strains

  • Patch fluorometry to correlate structure and function

• Protein quality checklist:

  • Verify complete amino acid sequence (1-140) without truncations

  • Confirm proper folding after reconstitution from lyophilized state

  • Test activity after different storage conditions

  • Assess stability using thermal shift assays

• Troubleshooting non-functional proteins:

  • Modify tag position or type if interference is suspected

  • Optimize reconstitution conditions (detergents, lipids)

  • Test different expression systems beyond E. coli

  • Consider codon optimization for heterologous expression

What are the best practices for storing and handling recombinant MscL proteins?

To maintain optimal stability and function of recombinant MscL proteins, researchers should follow these protocols:

• Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Perform aliquoting for multiple use to avoid repeated freeze-thaw cycles

  • For reconstituted protein, add 5-50% glycerol (final concentration) for long-term storage

  • Working aliquots can be stored at 4°C for up to one week

• Reconstitution protocol:

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Allow complete rehydration before functional assays

  • Default final concentration of glycerol for long-term storage is 50%

• Quality control checks:

  • Perform SDS-PAGE to confirm integrity after reconstitution

  • Measure protein concentration using standardized methods

  • Verify activity of representative samples from each batch

  • Document number of freeze-thaw cycles for each aliquot

• Common pitfalls to avoid:

  • Repeated freeze-thaw cycles significantly reduce activity

  • Protein aggregation at high concentrations

  • Extended storage of dilute solutions without stabilizers

  • Exposure to extreme pH or detergents that may denature the protein

How can researchers accurately quantify MscL channel numbers in bacterial membranes?

Accurate quantification of MscL channel numbers in bacterial membranes requires specialized techniques:

• Fluorescence microscopy approaches:

  • Construct chromosomally integrated MscL-fluorescent protein fusions (e.g., MscL-sfGFP)

  • Validate that fusion proteins maintain wild-type functionality through electrophysiology

  • Measure fluorophore maturation rates to correct for immature non-fluorescent proteins

  • Quantify potential aggregates to ensure accurate counting

• Calibration methods:

  • Use a "standard candle" strain with known MscL copy number

  • Calculate a calibration factor by dividing mean total cell fluorescence by known MscL copy number

  • Apply this calibration factor to convert arbitrary fluorescence units to MscL channels

  • Test sensitivity to various growth media and conditions

• Complementary techniques:

  • Quantitative Western blotting with purified standards

  • Targeted proteomics using mass spectrometry

  • Single-molecule localization microscopy for direct counting

  • Flow cytometry for high-throughput population analysis

• Statistical considerations:

  • Account for cell-to-cell variability in expression levels

  • Apply appropriate noise models for low-copy proteins

  • Consider cell size and growth phase effects on channel density

  • Use bootstrapping methods to estimate confidence intervals

What computational approaches can advance our understanding of MscL function?

Computational approaches offer powerful tools for investigating MscL function:

• Molecular dynamics (MD) simulations:

  • All-atom simulations of MscL in lipid bilayers

  • Coarse-grained models for longer timescale events

  • Steered MD to simulate membrane tension effects

  • Free energy calculations to determine energetics of conformational changes

• Finite element (FE) modeling:

  • Model mechanical properties of the channel and membrane

  • Simulate stress distribution during membrane deformation

  • Predict structural responses to mechanical stimuli

  • Integrate with experimental data to refine mechanical models

• Computational workflow for MscL research:

  • Begin with homology modeling based on available structures

  • Refine models using experimental constraints from EPR or other structural data

  • Simulate channel behavior under various conditions

  • Generate testable hypotheses for experimental validation

• Emerging computational techniques:

  • Machine learning approaches for pattern recognition in channel dynamics

  • Quantum mechanical calculations for specific interaction sites

  • Network analysis to identify allosteric pathways

  • Multiscale modeling to bridge molecular and cellular levels

How does MscL channel function relate to Xanthomonas oryzae pv. oryzae virulence?

The relationship between MscL channel function and virulence in Xanthomonas oryzae pv. oryzae involves several interconnected mechanisms:

• Osmotic protection during infection:

  • MscL provides protection against hypoosmotic stress encountered during plant infection

  • Enables bacterial survival during transitions between different plant tissue environments

  • May contribute to adaptation to changing conditions in the rice vascular system

• Oxidative stress response:

  • Bacterial pathogens encounter reactive oxygen species (ROS) produced by host defense mechanisms

  • Manganese (Mn²⁺) plays a crucial role in protection against oxidative stress

  • MscL may interact with systems regulating cellular ion concentrations, including Mn²⁺

  • Mutations affecting Mn²⁺ efflux can alter viability under oxidative stress and virulence

• Biofilm formation:

  • Recent studies have linked membrane proteins to biofilm formation in Xanthomonas oryzae pv. oryzae

  • Biofilm production is a critical virulence factor

  • Disruption of certain genes leads to reduced biofilm content and virulence

• Experimental approaches to study these connections:

  • Generate MscL knockout mutants and assess virulence in plant infection models

  • Combine mutations in MscL with other virulence factors to identify genetic interactions

  • Monitor expression of MscL during different stages of infection

  • Test survival of wild-type and mutant strains under conditions mimicking plant defense responses

How might MscL channels be targeted for antimicrobial development?

MscL channels represent potential targets for novel antimicrobial strategies against Xanthomonas oryzae pv. oryzae, with several approaches showing promise:

• Rationale for targeting MscL:

  • Essential role in osmotic protection

  • Structural differences from eukaryotic mechanosensitive channels

  • Involvement in stress responses related to virulence

  • Surface accessibility from extracellular space

• Potential targeting strategies:

  • Small molecules that lock the channel in open state, causing osmotic dysregulation

  • Peptides designed to interfere with channel gating

  • Compounds that alter interaction between MscL and the lipid bilayer

  • Targeting of gene expression regulatory elements

• Drug repurposing opportunities:

  • Integrating transcriptional data into genome-scale metabolic models (GSMM)

  • Screening existing compounds for activity against MscL function

  • Comparing response signatures with those of known antimicrobials

  • Exploring compounds that affect related bacterial systems

• Methodological approach to antimicrobial development:

  • High-throughput functional assays for MscL activity

  • Structure-based virtual screening using computational models

  • Liposome-based assays to test compound effects on channel function

  • In vivo efficacy testing in plant infection models

  • Resistance development assessment through serial passage experiments

What are the key considerations for comparing MscL channels across different Xanthomonas species?

When comparing MscL channels across different Xanthomonas species, researchers should consider:

• Sequence homology analysis:

  • Compare amino acid sequences of MscL from different Xanthomonas species

  • Identify conserved domains versus variable regions

  • Example: While highly conserved, there are subtle differences between sequences, such as those found in Xanthomonas oryzae pv. oryzae strains (B2SWL6: MGMVSEFKQFAIRGNVIDLAVGVVIGAAFGKIVTALVEK... vs. Q2P0I7: MGMVSEFQQFAIRGNVIDLAVGVVIGAAFGKIVTALVEK...)

  • Construct phylogenetic trees to analyze evolutionary relationships

• Functional comparisons:

  • Electrophysiological characterization of channel properties across species

  • Osmotic survival assays under standardized conditions

  • Gating threshold measurements in reconstituted systems

  • Expression level analysis under identical conditions

• Structural biology approaches:

  • Comparative modeling based on solved structures

  • Identification of species-specific structural features

  • Analysis of differences in oligomerization, C-terminal domain organization

  • Prediction of functional consequences of structural variations

• Genomic context analysis:

  • Examine organization of the mscL gene locus across species

  • Identify potential regulatory elements and their conservation

  • Analyze horizontal gene transfer patterns

  • Compare with related genes (e.g., other mechanosensitive channels)

What emerging technologies might advance our understanding of MscL channel dynamics?

Several emerging technologies hold promise for advancing our understanding of MscL channel dynamics:

• Advanced imaging techniques:

  • Cryo-electron microscopy for high-resolution structural analysis in different conformational states

  • Single-molecule FRET to monitor real-time conformational changes during gating

  • Super-resolution microscopy for visualizing channel distribution and clustering in native membranes

  • High-speed atomic force microscopy to observe dynamic structural changes

• Microfluidic platforms:

  • Devices allowing precise control of osmotic gradients while imaging

  • Single-cell analysis systems to correlate channel numbers with survival

  • Artificial cell systems reconstituting minimal components for MscL function

  • Organ-on-chip models to study channel function in more complex environments

• Genetic tools:

  • CRISPR-Cas9 genome editing for precise manipulation of MscL sequence

  • Optogenetic control of MscL expression or activity

  • Biosensors to report on membrane tension in vivo

  • Deep mutational scanning to comprehensively map sequence-function relationships

• Computational advances:

  • Enhanced sampling techniques for simulating rare gating events

  • Artificial intelligence approaches to identify patterns in channel behavior

  • Integration of multi-scale models from atomic to cellular levels

  • Cloud-based platforms for sharing and analyzing large datasets

How can researchers effectively combine in vitro and in vivo approaches to study MscL function?

Effectively combining in vitro and in vivo approaches to study MscL function requires careful experimental design:

• Integrated research strategy:

  • Begin with in vitro characterization of purified recombinant MscL

  • Validate findings in simplified cellular systems (e.g., liposomes, spheroplasts)

  • Transition to controlled in vivo systems with fluorescent reporters

  • Ultimately test hypotheses in native bacterial contexts including infection models

• Reconciling methodological differences:

  • Account for membrane composition differences between in vitro and in vivo systems

  • Consider the impact of cellular crowding absent in purified systems

  • Develop calibration strategies to compare quantitative measurements across platforms

  • Design controls that bridge between different experimental approaches

• Complementary strengths approach:

  • Use in vitro systems for precise biophysical measurements and mechanistic studies

  • Employ in vivo approaches to validate physiological relevance

  • Develop intermediate systems that maintain control while increasing complexity

  • Iterate between approaches to refine hypotheses and experimental designs

• Data integration framework:

  • Develop mathematical models that can incorporate data from multiple experimental systems

  • Use machine learning to identify patterns across diverse datasets

  • Establish clear criteria for resolving apparent contradictions between approaches

  • Create accessible databases that link in vitro parameters with in vivo outcomes