Recombinant Xanthomonas oryzae pv. oryzae Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid A Transport

MsbA is an ATP-binding cassette (ABC) transporter essential for flipping lipid A, a component of lipopolysaccharides (LPS), from the inner to the outer leaflet of the bacterial membrane . Key functional insights:

  • ATPase Activity: Stimulated by lipid A (K<sub>d</sub> ~0.35–10 μM) and dependent on nucleotide binding .

  • Substrate Binding:

    • Binds lipid A and amphipathic drugs (e.g., daunorubicin) at distinct sites .

    • Mutations (e.g., R188A/K243A) reduce lipid A affinity and ATPase stimulation .

SubstrateBinding SiteK<sub>d</sub>Functional Impact
Lipid AExterior basic patch0.35–1.0 μM Essential for LPS assembly
DaunorubicinHydrophobic pocket2–5 μM Linked to multidrug resistance

Biochemical Insights and Mutational Analysis

Recent structural studies reveal:

  • Copper Interaction: MsbA co-purifies with copper(II), suggesting a regulatory role in lipid binding .

  • Key Mutations:

    • R188A/K243A: Disrupts interaction with the phosphorylated glucosamine (P-GlcN) of lipid A, reducing ATPase stimulation by 50% .

    • R78A/K299A: Abolishes lipid A binding but retains responsiveness to full-length LPS (RaLPS) .

Expression System:

ParameterDetail
HostE. coli
TagN-terminal His
Yield0.1–1.0 mg/mL after reconstitution

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
msbA; XOO2175; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Target Names
msbA
Target Protein Sequence
MTNSTDRPVSVSSWRTYRRLVAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAIKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAVALTRAKGLIEFRDVTARYPGQVN PALADVSFIAQPGTVTAIVGRSGSGKSSLIKLIPRFYDAEAGQILLDGQPVQAYALADLR RQIALVGQQVMLFDGSIAENVAFGEMRSADASQLERAILGANAMEFVAQLPEGLQSHVGA KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHELLAQGGLYSHLHGMQFRERQA
Uniprot No.

Target Background

Function
This protein plays a role in lipopolysaccharide (LPS) biosynthesis. It translocates lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xom:XOO2175

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MsbA in Xanthomonas oryzae pv. oryzae?

MsbA in Xanthomonas oryzae pv. oryzae functions as an essential ATP-binding cassette (ABC) transporter that facilitates the translocation of lipid A and lipopolysaccharide (LPS) from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane. It is functionally characterized as a lipid flippase, playing a critical role in the biogenesis of the outer membrane in this gram-negative bacterium. This transport activity is energy-dependent, requiring ATP hydrolysis to drive the conformational changes necessary for substrate movement across the membrane . The proper functioning of MsbA is essential for bacterial viability, as it enables the export of these membrane components that are synthesized in the cytoplasm but must function in the outer membrane.

How does MsbA structural conformation relate to its function?

MsbA undergoes significant conformational changes during its transport cycle. X-ray crystallography studies have revealed that MsbA can adopt an inward-facing conformation with a large amplitude opening in the transmembrane portal. This opening likely allows lipid A to enter from its site of synthesis into the protein-enclosed transport pathway . The protein then transitions through intermediate states to an outward-facing conformation that enables release of the substrate into the periplasmic leaflet. These structural transitions are coordinated with ATP binding, hydrolysis, and release at the nucleotide-binding domains. Electron density attributed to lipid A has been observed both inside the transmembrane cavity and near an outer surface cleft at the periplasmic ends of the transmembrane helices, supporting a "trap and flip" model of transport .

What is the relationship between MsbA and bacterial blight in rice?

Bacterial blight, caused by Xanthomonas oryzae pv. oryzae (Xoo), is one of the most serious diseases affecting rice production, particularly in Asia and parts of Africa . As an essential component of the cell envelope biogenesis machinery, MsbA contributes to bacterial viability and potentially to virulence. The proper assembly of LPS in the outer membrane is critical for bacterial survival, adaptation to environmental stresses, and interaction with host tissues. Disruption of MsbA function could potentially attenuate bacterial virulence by compromising membrane integrity and altering the presentation of surface molecules that interact with host cells.

How do the structural properties of Xoo MsbA compare to MsbA proteins in other bacterial species?

The structural properties of Xoo MsbA likely share fundamental similarities with other bacterial MsbA proteins, particularly those from other gram-negative species. Comparative analysis with the 2.8 Å X-ray structure of MsbA from Salmonella typhimurium has revealed important insights about the lipid A transport pathway . Both proteins likely feature the characteristic ABC transporter architecture with transmembrane domains that form the substrate pathway and nucleotide-binding domains that power the transport cycle through ATP hydrolysis.

  • The size and shape of the substrate-binding pocket, reflecting adaptations to the specific lipid A structure in Xoo

  • Surface-exposed loops that may interact with other cellular components

  • Regulatory elements that control transport activity in response to environmental or cellular signals

  • Amino acid residues at the transmembrane portal that determine substrate specificity

These differences could potentially be exploited for the development of species-specific inhibitors that target Xoo MsbA without affecting beneficial bacteria.

What experimental approaches are most effective for studying MsbA conformational changes?

Several complementary approaches have proven valuable for investigating the conformational dynamics of MsbA:

  • X-ray Crystallography: Provides high-resolution static structures of specific conformational states, as demonstrated by the 2.8 Å structure of Salmonella MsbA in an inward-facing conformation .

  • Cryo-Electron Microscopy: Captures conformational ensembles under near-native conditions and has been successfully applied to visualize LPS-bound structures.

  • Double Electron-Electron Resonance (DEER) Spectroscopy: Measures distances between strategically placed spin labels to track domain movements during the transport cycle.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Identifies regions of the protein that undergo conformational changes based on their solvent accessibility.

  • Molecular Dynamics Simulations: Models the dynamic behavior of the protein in a lipid bilayer environment, providing insights into conformational transitions that may be difficult to capture experimentally.

A comprehensive understanding of MsbA conformational dynamics typically requires integration of data from multiple techniques, as each approach has distinct strengths and limitations.

How can researchers design effective inhibitors targeting Xoo MsbA?

The design of effective inhibitors for Xoo MsbA could follow several strategic approaches:

  • Structure-Based Design: Utilizing the available structural information on MsbA proteins to identify potential binding pockets for small molecules. The large amplitude opening in the transmembrane portal, observed in the inward-facing conformation, provides a potential target for inhibitors that could prevent substrate binding .

  • ATP-Competitive Inhibitors: Developing compounds that compete with ATP binding at the nucleotide-binding domains, thereby preventing the energy-dependent conformational changes necessary for transport.

  • Allosteric Inhibitors: Targeting sites distant from the substrate-binding pocket that could stabilize MsbA in an inactive conformation.

  • Substrate-Mimetic Approach: Designing molecules that mimic structural features of lipid A but cannot be transported, thereby occupying the binding site without productive transport.

  • Combination with Permeability Enhancers: Developing inhibitors that not only block MsbA function but also increase membrane permeability, potentially enhancing the efficacy of co-administered antibiotics.

Researchers should consider potential cross-reactivity with human ABC transporters and potential effects on beneficial microbiota when designing MsbA inhibitors.

What expression systems are most suitable for producing recombinant Xoo MsbA protein?

The selection of an appropriate expression system for recombinant Xoo MsbA should consider the following factors:

  • Bacterial Expression Systems:

    • E. coli: Often the first choice due to rapid growth and high yields, but may require optimization for membrane protein expression using special strains (C41/C43, Lemo21) and tunable promoters.

    • Lactococcus lactis: Alternative bacterial host that often provides better folding for membrane proteins due to slower expression kinetics.

  • Yeast Expression Systems:

    • Pichia pastoris: Offers advantages for membrane protein expression including proper folding machinery and capacity for post-translational modifications.

    • Saccharomyces cerevisiae: Well-established genetic tools but typically lower yields than P. pastoris.

  • Insect Cell Expression:

    • Baculovirus-infected Sf9 or Hi5 cells: Provide eukaryotic folding environment with high expression capacity for complex membrane proteins.

  • Cell-Free Expression:

    • Allows direct incorporation into nanodiscs or liposomes, avoiding extraction and reconstitution steps.

The optimal expression tags (His, GST, MBP) and their placement (N- or C-terminal) should be empirically determined for Xoo MsbA, as should expression conditions including temperature, induction parameters, and media composition.

What purification strategies are most effective for Xoo MsbA?

A multi-step purification approach for Xoo MsbA typically includes:

  • Membrane Preparation:

    • Cell disruption via sonication, microfluidization, or French press

    • Differential centrifugation to isolate membrane fractions

    • Removal of peripheral membrane proteins with high-salt washes

  • Detergent Extraction:

    • Screening of detergents (DDM, LMNG, UDM) for optimal solubilization

    • Gentle extraction conditions to maintain native conformation

  • Affinity Chromatography:

    • IMAC (Immobilized Metal Affinity Chromatography) for His-tagged constructs

    • Anti-FLAG or Strep-Tactin chromatography for alternatively tagged constructs

  • Additional Purification Steps:

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Ion exchange chromatography for increased purity

  • Stability Assessment:

    • Thermal stability assays (e.g., SEC-MALS, DSF) to optimize buffer conditions

    • ATPase activity assays to confirm functional state

  • Reconstitution:

    • Transfer to more stable membrane mimetics (nanodiscs, liposomes) for functional studies

Careful attention to buffer composition, particularly pH, salt concentration, and glycerol content, is critical for maintaining protein stability throughout the purification process.

How can researchers effectively analyze the ATPase activity of Xoo MsbA?

Analysis of Xoo MsbA ATPase activity can be performed using several complementary approaches:

  • Colorimetric Phosphate Detection:

    • Malachite green assay: Simple, sensitive measurement of released inorganic phosphate

    • NADH-coupled assay: Continuous monitoring of ATP hydrolysis through linked enzyme reactions

  • Radioisotope-Based Methods:

    • [γ-32P]ATP hydrolysis: Direct and sensitive quantification of ATP hydrolysis

    • Filter-binding assays to separate unreacted ATP from released phosphate

  • Luminescence-Based Assays:

    • ATP consumption measured by decrease in luciferase signal

    • Suitable for high-throughput screening applications

  • Basal vs. Stimulated Activity:

    • Assessment of basal activity compared to lipid A-stimulated activity

    • Analysis of the effects of various lipid species on ATPase stimulation

  • Kinetic Parameters:

    • Determination of KM, Vmax, and catalytic efficiency

    • Analysis of the effects of potential inhibitors on kinetic parameters

Careful control experiments should include:

  • Heat-inactivated enzyme controls

  • Controls for non-enzymatic ATP hydrolysis

  • Verification that measured activity is sensitive to known ABC transporter inhibitors (e.g., vanadate)

How should researchers interpret structural data for MsbA with seemingly contradictory conformations?

When analyzing seemingly contradictory structural data for MsbA, researchers should consider:

  • Physiological Relevance of Observed Conformations:

    • The wide-open conformer observed in some X-ray structures (e.g., PDB 3B5W with 5.3 Å resolution) has been debated regarding its physiological relevance .

    • Compare with structures obtained in different experimental conditions, particularly regarding detergent choice and presence of stabilizing agents.

  • Dynamic Nature of ABC Transporters:

    • MsbA undergoes large conformational changes during its transport cycle.

    • Apparently contradictory structures may represent different states in this cycle.

    • Consider the potential influence of crystal contacts on the observed conformations.

  • Resolution Considerations:

    • Higher-resolution structures (e.g., 2.8 Å) generally provide more reliable atomic details than lower-resolution ones (e.g., 5.3 Å) .

    • Assess the quality metrics of each structure (R-factor, Ramachandran statistics, etc.).

  • Experimental Conditions:

    • Presence or absence of nucleotides, substrate, or inhibitors

    • Different detergents or membrane mimetics used for crystallization

    • Use of facial amphiphiles or other stabilizing agents

  • Integration with Complementary Data:

    • Cross-validate structural models with biochemical data on cross-linking, accessibility, and functional states.

    • Consider solution-based structural techniques (SAXS, SANS) that may capture conformational ensembles.

A comprehensive interpretation should integrate structural data with functional assays to build a coherent model of the transport cycle.

What approaches are recommended for studying the interaction between MsbA and lipid A in Xoo?

Several approaches can be employed to study MsbA-lipid A interactions in Xoo:

  • Binding Assays:

    • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics

    • Microscale Thermophoresis (MST): Solution-based technique requiring small amounts of protein

    • Isothermal Titration Calorimetry (ITC): Direct measurement of binding thermodynamics

  • Structural Studies:

    • Co-crystallization with lipid A, as demonstrated for Salmonella MsbA

    • Cryo-EM analysis of MsbA-lipid A complexes

    • Hydrogen-Deuterium Exchange Mass Spectrometry to identify regions with altered solvent accessibility upon lipid A binding

  • Mutagenesis Approaches:

    • Alanine-scanning mutagenesis of putative lipid A-binding residues

    • Generation of chimeric proteins with other bacterial MsbA proteins to identify species-specific interaction determinants

  • Computational Methods:

    • Molecular docking of lipid A into MsbA structures

    • Molecular dynamics simulations of MsbA-lipid A complexes in membrane environments

  • Transport Assays:

    • Development of reconstituted systems (proteoliposomes) for measuring lipid A flipping

    • Fluorescently labeled lipid A analogs for tracking transport in real-time

Integration of these approaches can provide a comprehensive understanding of how Xoo MsbA recognizes, binds, and transports its lipid A substrate.

How does Xoo MsbA relate to bacterial resistance mechanisms against host defenses?

Xoo MsbA may contribute to bacterial resistance against host defenses through several mechanisms:

  • Lipopolysaccharide (LPS) Modification:

    • MsbA transports lipid A and LPS to the outer membrane, where modifications to these molecules can alter recognition by host immune receptors .

    • The rice pathogen recognition receptor XA21 confers resistance to Xoo strains producing specific molecular patterns, which may involve LPS components .

  • Maintenance of Membrane Integrity:

    • Proper LPS transport and assembly is critical for the barrier function of the outer membrane.

    • Intact membrane integrity protects against antimicrobial compounds produced by the host.

  • Interaction with Two-Component Regulatory Systems:

    • The PhoPQ two-component system in Xoo is important for virulence .

    • Potential functional connections between MsbA activity and virulence regulation by systems like PhoPQ could influence adaptation to host environments.

  • Contribution to Antibiotic Resistance:

    • MsbA may play a role in intrinsic resistance to certain antimicrobial compounds through efflux or altered membrane permeability.

    • Changes in MsbA expression or activity could affect susceptibility to host-derived antimicrobial compounds.

  • Influence on Bacterial Virulence Factor Secretion:

    • Proper membrane organization facilitated by MsbA could be necessary for the function of secretion systems that deliver virulence factors into host cells.

Understanding these relationships could provide insights into potential therapeutic approaches that target MsbA to enhance host defense mechanisms against Xoo infection.

What are the most promising approaches for developing MsbA-targeted interventions against bacterial blight?

Several approaches hold promise for developing MsbA-targeted interventions against bacterial blight:

  • Small Molecule Inhibitors:

    • Structure-based design of compounds that bind to critical functional sites on MsbA

    • High-throughput screening of chemical libraries against purified Xoo MsbA

    • Repurposing of existing ABC transporter inhibitors with modification for selectivity

  • Peptide-Based Inhibitors:

    • Development of peptides that mimic critical interfaces in MsbA structure

    • Cell-penetrating peptides that can reach the inner membrane and interfere with MsbA function

  • Genetic Approaches:

    • CRISPR-Cas9 delivery systems targeting msbA gene expression

    • Antisense RNA strategies to reduce MsbA production

    • Engineered phages that specifically target Xoo carrying genetic cargo to disrupt MsbA function

  • Combination Approaches:

    • Co-application of MsbA inhibitors with traditional antibiotics to increase efficacy

    • Pairing with compounds that disrupt membrane integrity

  • Plant-Based Resistance Strategies:

    • Enhancing plant recognition of MsbA-dependent membrane components

    • Engineering crops with resistance genes that recognize Xoo surface structures dependent on MsbA function

Each approach should be evaluated not only for efficacy but also for specificity to Xoo MsbA, potential for resistance development, and compatibility with agricultural practices.

How can researchers address the challenges of studying membrane proteins like MsbA in Xoo?

Addressing the challenges of studying Xoo MsbA requires multifaceted strategies:

  • Expression and Purification Optimization:

    • Systematic testing of expression vectors, host strains, and growth conditions

    • Fusion partners that enhance folding and stability (e.g., GFP, MBP)

    • Detergent screening using stability assays (e.g., SEC-MALS, DSF)

    • Use of novel membrane mimetics (SMALPs, nanodiscs, amphipols)

  • Functional Assay Development:

    • Establishment of robust ATPase activity assays specific to Xoo MsbA

    • Development of lipid A transport assays in reconstituted systems

    • Adaptation of existing assays for high-throughput applications

  • Structural Biology Approaches:

    • Integration of X-ray crystallography, cryo-EM, and NMR for structural characterization

    • Use of stabilizing facial amphiphiles to facilitate crystallization

    • Application of single-particle cryo-EM to bypass crystallization requirements

  • Genetic Systems for in vivo Studies:

    • Development of conditional mutants for essential genes like msbA

    • Fluorescent protein fusions for localization studies

    • CRISPR interference for tunable gene expression

  • Computational Approaches:

    • Homology modeling based on structures from related organisms

    • Molecular dynamics simulations to predict behavior in membrane environments

    • Machine learning approaches to predict structure-function relationships

By combining these approaches, researchers can overcome the inherent difficulties of working with membrane proteins to gain meaningful insights into Xoo MsbA function and its potential as a target for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.