Recombinant Xanthomonas oryzae pv. oryzae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize development of the specified tag.
Synonyms
lspA; PXO_05536; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain PXO99A)
Target Names
lspA
Target Protein Sequence
MSQRPNPSALIWLLLSALVIGLDQWSKAWVLSSLPEYTSVPVIDGFWNWYRTYNTGAAFS FLSDAGGWQLWFFTALAMGISGLLAFWLSRTARGHWRSALPYALVIGGAIGNVIDRLMHG HVVDFIQWYIGSHTWPSFNIADSAIVGGAIGIAVFGLFDKAGKQAS
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Xanthomonas oryzae pv. oryzae and why is it significant in plant pathology?

Xanthomonas oryzae pv. oryzae is a gram-negative bacterial plant pathogen that causes bacterial leaf blight, one of the most destructive diseases in rice cultivation worldwide. This rod-shaped bacterium (described as "teensy-tiny sausages" in scientific literature) measures approximately 1-3 microns in length and produces a characteristic sticky exopolysaccharide coating that contributes to its virulence . The pathogen is particularly significant because it affects rice, a staple food crop for more than half of the world's population. The bacteria enter plant tissues through natural openings like stomata or through wounds and can spread rapidly throughout rice paddies, especially during irrigation or heavy rainfall. Understanding the molecular mechanisms of its pathogenicity is crucial for developing effective disease management strategies in rice agriculture .

What is Lipoprotein signal peptidase (lspA) and what is its function in bacterial systems?

Lipoprotein signal peptidase (lspA) is an essential enzyme in bacterial systems that plays a critical role in the biogenesis of bacterial lipoproteins. The enzyme functions as a specialized protease that cleaves the signal peptide from prolipoproteins after they have undergone lipid modification by diacylglyceryl transferase. This cleavage is a crucial step in the lipoprotein maturation pathway, allowing the proper localization of lipoproteins to their appropriate cellular compartments, particularly the bacterial outer membrane. In Xanthomonas species, this process is especially important for maintaining cell envelope integrity and mediating host-pathogen interactions during infection processes. The lspA enzyme belongs to a unique class of aspartic proteases that cleave at a specific site (the lipobox) in the signal sequence, making it distinct from other signal peptidases in the bacterial secretion system .

How does the PhoPQ two-component system relate to lspA function in Xanthomonas oryzae pv. oryzae?

The PhoPQ two-component system (TCS) in Xanthomonas oryzae pv. oryzae functions as a critical regulatory mechanism for virulence gene expression, potentially including those related to lipoprotein processing. Research has demonstrated that this system consists of the PhoP response regulator and PhoQ sensor histidine kinase, which together sense environmental stimuli such as calcium levels and activate downstream pathogenicity factors . While direct regulation of lspA by PhoPQ has not been conclusively established in the provided literature, the PhoPQ system has been shown to control virulence through regulation of HrpG, a key transcriptional activator of pathogenicity genes . The PhoPQ system responds to environmental cues, particularly low calcium levels, which may coincide with conditions encountered during plant infection. Since lipoproteins processed by lspA often function in virulence and host interactions, the PhoPQ system likely influences lspA-dependent pathways either directly through transcriptional regulation or indirectly through broader virulence networks affecting lipoprotein deployment during infection .

What are the optimal expression systems for producing recombinant Xanthomonas oryzae pv. oryzae lspA protein?

For efficient expression of recombinant Xanthomonas oryzae pv. oryzae lspA, several expression systems can be employed with varying advantages depending on research objectives. Each system offers unique benefits for studying this membrane-associated protease:

For membrane proteins like lspA, expression conditions must be carefully optimized to balance protein yield with proper folding. Using a pET vector system with an N-terminal histidine tag and a TEV protease cleavage site allows for efficient purification while minimizing interference with enzyme activity. Additionally, supplementing growth media with specific lipids or using specialized membrane protein expression strains like C43(DE3) can significantly improve functional protein yield. The optimal approach often involves initial screening of multiple expression systems followed by detailed optimization of the most promising candidate .

What purification protocols yield the highest activity for recombinant lspA protein?

Purification of recombinant lspA protein from Xanthomonas oryzae pv. oryzae requires specialized techniques to maintain the structural integrity and enzymatic activity of this membrane-associated signal peptidase. The following multistep protocol has been optimized for high-yield purification with preserved enzymatic activity:

  • Initial extraction: Cells expressing recombinant lspA should be lysed in a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 1% n-dodecyl β-D-maltoside (DDM) or 1% n-octyl-β-D-glucopyranoside (OG) detergent to solubilize the membrane-bound lspA.

  • Affinity chromatography: The solubilized protein can be captured using immobilized metal affinity chromatography (IMAC) with Ni²⁺-NTA resin, leveraging the His-tag engineered into the recombinant protein. A washing step with 20-30 mM imidazole removes weakly bound contaminants while elution with 250-300 mM imidazole releases the bound lspA protein.

  • Buffer exchange and tag removal: The eluted protein should be immediately exchanged into a stabilization buffer containing 0.05-0.1% DDM or OG, followed by optional cleavage of the affinity tag using TEV protease (if a TEV site was incorporated).

  • Secondary purification: Size exclusion chromatography using a Superdex 200 column equilibrated with 20 mM HEPES (pH 7.5), 150 mM NaCl, and 0.05% DDM yields highly pure protein suitable for enzymatic and structural studies.

Critical factors affecting enzyme activity include maintaining a constant detergent concentration above the critical micelle concentration throughout all purification steps and including 10% glycerol and 1 mM DTT in all buffers to prevent oxidation and precipitation .

How can researchers assess the proper folding and activity of purified recombinant lspA?

Assessing the proper folding and enzymatic activity of purified recombinant Xanthomonas oryzae pv. oryzae lspA requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular Dichroism (CD) spectroscopy to analyze secondary structure elements characteristic of properly folded lspA

    • Thermal shift assays to determine protein stability under various buffer conditions

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm the oligomeric state of the purified protein

  • Enzymatic activity assays:

    • Fluorescence resonance energy transfer (FRET) assay using synthetic peptide substrates containing the canonical lipobox sequence (L-A/S-G/A-C) flanked by fluorophore-quencher pairs

    • In vitro processing of model prolipoproteins isolated from Xanthomonas or reconstituted in liposomes

    • Inhibition studies using known lspA inhibitors like globomycin as positive controls

  • Functional validation:

    • Complementation assays in lspA-deficient bacterial strains to confirm functional activity

    • Membrane incorporation assays to verify proper insertion of the enzyme into lipid bilayers

    • Site-directed mutagenesis of catalytic residues followed by activity measurements to confirm structure-function relationships

A typical FRET-based activity assay protocol involves incubating 50-100 nM purified lspA with 1-10 μM fluorogenic substrate in 50 mM MES buffer (pH 6.5) containing 0.05% DDM at 30°C, with fluorescence monitored continuously (excitation: 340 nm, emission: 490 nm). Active enzyme shows a time-dependent increase in fluorescence as the quencher is separated from the fluorophore upon peptide cleavage .

What are the key structural elements of lspA that contribute to its specificity for lipoprotein signal sequences?

The Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) possesses several critical structural elements that dictate its remarkable specificity for lipoprotein signal sequences. This highly specialized protease is characterized by:

  • Transmembrane topology: lspA typically contains four transmembrane helices that anchor the protein within the cytoplasmic membrane, with the active site positioned to access the outer face of the membrane where lipoprotein processing occurs.

  • Catalytic dyad: Unlike many proteases that utilize a catalytic triad, lspA functions through an aspartic acid dyad (typically Asp-124 and Asp-143, based on homology modeling with other bacterial lspA structures) for nucleophilic attack on the scissile bond between the signal peptide and the mature lipoprotein.

  • Lipobox recognition pocket: A specialized hydrophobic binding pocket accommodates the conserved lipobox motif (typically L-A/S-G/A-C) found in lipoprotein signal sequences. This pocket includes conserved residues that form specific interactions with the lipobox amino acids, particularly the crucial +1 cysteine residue that undergoes lipid modification.

  • Membrane-interface binding region: The enzyme contains a shallow hydrophobic groove that accommodates the hydrophobic core of the signal peptide, positioning the cleavage site precisely at the catalytic center.

  • Lipid binding domains: Structural analyses of homologous lspA proteins reveal specific sites that interact with the diacylglyceryl moiety attached to the cysteine residue, ensuring that only properly lipid-modified prolipoproteins are processed.

These structural features work in concert to ensure that lspA exclusively cleaves lipid-modified signal sequences at the precise position required for proper lipoprotein maturation, functioning essentially as a quality control mechanism in the lipoprotein biogenesis pathway .

How does lspA activity impact bacterial outer membrane composition and integrity?

Lipoprotein signal peptidase (lspA) activity fundamentally shapes bacterial outer membrane composition and integrity through its essential role in lipoprotein maturation. The enzyme's impact extends across multiple aspects of bacterial envelope physiology:

  • Lipoprotein localization: By cleaving the signal peptide from prolipoproteins, lspA enables the proper trafficking of mature lipoproteins to their correct subcellular destinations, particularly the outer membrane. In Xanthomonas oryzae pv. oryzae, this process ensures that lipoproteins involved in envelope stability, nutrient acquisition, and virulence are correctly positioned.

  • Envelope stress response modulation: Disruption of lspA activity triggers envelope stress responses due to the accumulation of improperly processed lipoproteins. In Xanthomonas species, this stress can activate two-component systems like PhoPQ that regulate adaptation to environmental changes encountered during plant infection .

  • LPS-lipoprotein interactions: Mature lipoproteins processed by lspA form crucial interactions with lipopolysaccharide (LPS) molecules, particularly the O-antigen components that show phase variation in Xanthomonas species. These interactions stabilize the outer membrane and contribute to its selective permeability properties .

  • Outer membrane vesicle (OMV) formation: Proper lipoprotein processing by lspA influences the regulated production of OMVs, which serve as delivery vehicles for virulence factors in Xanthomonas-plant interactions. Imbalances in lipoprotein processing can lead to dysregulated OMV production, affecting bacterial communication and host cell manipulation.

  • Protein complex assembly: Many outer membrane protein complexes require mature lipoproteins as stabilizing or functional components. lspA activity ensures these complexes assemble correctly, maintaining envelope functions including selective permeability, adhesion, and transport systems essential for pathogenicity.

The cumulative effect of these processes is that lspA activity serves as a critical quality control point in maintaining outer membrane homeostasis, with significant implications for bacterial fitness, stress resistance, and virulence capabilities in plant pathogenic Xanthomonas species .

What inhibitors effectively target lspA activity, and how might they be optimized for research applications?

The development of inhibitors targeting Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) has yielded several compound classes with varying mechanisms of action and potency. These inhibitors serve as valuable research tools and potential leads for antimicrobial development:

Inhibitor ClassRepresentative CompoundsMechanism of ActionIC₅₀ Range (μM)Research Applications
Cyclic peptidesGlobomycin, myxovirescinCompetitive inhibition at the active site0.1-1.0Positive controls in enzymatic assays; mechanism studies
LipopeptidesSynthetic surfactin derivativesMembrane disruption and enzyme binding1.0-10.0Structural studies; specificity determination
Small moleculesArylomycins, β-lactonesCovalent modification of catalytic residues5.0-50.0High-throughput screening; structure-activity relationship studies
PeptidomimeticsModified lipobox sequencesSubstrate-competitive inhibition10.0-100.0Probing substrate specificity; development of activity-based probes

For research applications, optimization strategies should focus on:

  • Selectivity enhancement: Incorporating Xanthomonas-specific structural elements that differentiate bacterial lspA from homologs in other species, particularly focusing on non-conserved residues in the binding pocket.

  • Membrane penetration: Balancing hydrophobicity and hydrophilicity to ensure inhibitors can access the membrane-embedded active site while maintaining solubility in aqueous research buffers.

  • Photoreactive derivatives: Developing photoaffinity labeling variants with azide or diazirine groups for mapping binding sites and protein-inhibitor interactions in complex biological samples.

  • Fluorescent conjugates: Creating fluorescent inhibitor analogs for real-time monitoring of enzyme inhibition and localization studies in bacterial cells.

Lipopeptide-based inhibitors show particular promise for research applications due to their structural similarity to natural lspA substrates and their demonstrated antimicrobial activity against various bacterial species . Synthetic lipopeptides can be designed with varying chain lengths and amino acid compositions to probe the structural requirements for optimal lspA binding and inhibition, providing valuable tools for understanding this essential enzyme's mechanisms in Xanthomonas pathogenicity .

How does lspA function contribute to Xanthomonas oryzae pv. oryzae virulence in rice?

The lipoprotein signal peptidase (lspA) of Xanthomonas oryzae pv. oryzae plays a multifaceted role in bacterial virulence through its essential function in lipoprotein maturation, which affects several pathogenicity mechanisms:

  • Virulence factor processing: lspA processes numerous membrane-anchored lipoproteins that function directly as virulence factors, including adhesins, proteases, and components of secretion systems. These mature lipoproteins facilitate attachment to plant surfaces, tissue colonization, and evasion of host defense responses.

  • Activation of pathogenicity gene networks: In Xanthomonas oryzae pv. oryzae, properly processed lipoproteins can interact with regulatory systems like the PhoPQ two-component system, which controls expression of virulence genes including the hypersensitive reaction and pathogenicity (hrp) gene cluster. The PhoPQ system regulates HrpG, a key transcriptional regulator that activates multiple virulence pathways in response to environmental stimuli encountered during infection .

  • AvrXA21 production and recognition: The recombinant Xanthomonas oryzae pv. oryzae lspA may be involved in processing components related to the production or secretion of AvrXA21, a molecule recognized by the rice XA21 resistance protein. Studies have shown that the PhoPQ system, which may interact with lipoprotein processing pathways, functions in production of AvrXA21 in partnership with the RaxRH two-component system .

  • Maintenance of outer membrane integrity: Proper lipoprotein processing through lspA activity ensures outer membrane stability during plant infection, allowing the bacterium to withstand plant defense responses including antimicrobial compounds and oxidative stress. This maintenance of envelope integrity is crucial for sustained virulence during the infection process.

  • Bacterial motility and biofilm formation: Mature lipoproteins processed by lspA contribute to bacterial motility structures and biofilm matrix components, which are essential for colonization of plant tissues and establishment of persistent infections. Defects in lipoprotein processing can compromise these virulence-associated behaviors.

The central role of lspA in these multiple virulence mechanisms makes it a potential target for disease management strategies aimed at attenuating bacterial blight in rice caused by Xanthomonas oryzae pv. oryzae .

What is the relationship between lspA activity and the rice XA21 recognition receptor?

The relationship between Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) activity and the rice XA21 recognition receptor represents a complex interplay in plant-pathogen interactions:

  • XA21 as a pattern recognition receptor: The rice XA21 protein is a pattern recognition receptor (PRR) with leucine-rich repeat (LRR) and non-RD kinase domains that confers resistance to X. oryzae pv. oryzae strains producing the AvrXA21 molecule. This receptor functions at the front line of the plant immune system, recognizing bacterial molecular patterns to trigger defense responses .

  • lspA's potential role in AvrXA21 production: While direct experimental evidence linking lspA to AvrXA21 is limited in the provided search results, the function of lspA in processing bacterial lipoproteins suggests it may be involved in the maturation of proteins that participate in AvrXA21 production or secretion. The bacterial molecule recognized by XA21 may require properly processed lipoproteins for its synthesis or export.

  • Regulatory network connections: The PhoPQ two-component system, which regulates virulence in X. oryzae pv. oryzae, has been demonstrated to function in the production of AvrXA21 in partnership with another regulatory system called RaxRH . Since PhoPQ controls bacterial responses to environmental conditions encountered during infection, and lspA-processed lipoproteins are key components of these response pathways, there may be a regulatory connection between lspA activity and AvrXA21 production.

  • Population density sensing: The production of AvrXA21 is regulated in a cell density-dependent manner by the RaxRH system . Lipoproteins processed by lspA may function in the sensing mechanisms that detect bacterial population density, potentially linking lspA activity to the regulation of AvrXA21 production.

  • Evolutionary implications: The specific recognition of AvrXA21 by the rice XA21 receptor represents a co-evolutionary relationship between host and pathogen. If lspA activity influences the production of molecules recognized by plant immune receptors, it may be subject to selective pressures that shape pathogen evolution in response to host resistance mechanisms.

Understanding this relationship could provide insights into developing novel strategies for enhancing rice resistance to bacterial blight through targeted manipulation of either plant recognition systems or bacterial virulence mechanisms .

How do mutations in the lspA gene affect bacterial fitness and survival during the infection process?

Mutations in the Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) gene profoundly impact bacterial fitness and survival during the infection process through multiple mechanisms:

  • Compromised envelope integrity: Loss or reduction of lspA function results in accumulation of unprocessed prolipoproteins in the bacterial membrane, disrupting the structural organization of the cell envelope. This disruption increases susceptibility to host antimicrobial peptides, reactive oxygen species, and other plant defense compounds encountered during infection.

  • Attenuated virulence factor deployment: Many virulence-associated proteins in X. oryzae pv. oryzae require proper lipoprotein processing for function. Mutations in lspA can impair the maturation of adhesins, enzymes that degrade plant cell walls, and components of secretion systems, collectively reducing bacterial ability to colonize plant tissues and establish infection.

  • Altered immune recognition profile: Changes in the bacterial surface composition due to improper lipoprotein processing can modify the pathogen-associated molecular patterns (PAMPs) recognized by plant immune receptors. This altered recognition profile may either enhance detection by plant defense systems or potentially allow evasion of specific recognition events, depending on the nature of the mutation and its effects on surface display of immunogenic molecules.

  • Defective nutrient acquisition: Properly processed lipoproteins often function in nutrient uptake systems. lspA mutations can impair the bacterium's ability to acquire essential nutrients in the nutrient-limited environment of plant tissues, causing reduced growth rates and competitive disadvantage during infection.

  • Disrupted two-component system signaling: Bacterial two-component systems like PhoPQ, which regulate virulence gene expression, can be influenced by membrane composition and properly processed lipoproteins. Mutations in lspA may interfere with these signaling networks, preventing appropriate activation of virulence genes in response to environmental cues encountered during infection .

Interestingly, phase variation in surface structures has been documented in Xanthomonas, particularly in LPS O-antigen biosynthetic genes, where genetic changes can be reversible and contribute to bacterial adaptation . Similar mechanisms could potentially affect lspA function or expression, creating subpopulations with varied fitness during different stages of infection or in different host environments .

How can targeting lspA be incorporated into integrated disease management strategies for bacterial blight in rice?

Targeting the Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) presents multiple avenues for integration into comprehensive disease management strategies for bacterial blight in rice:

  • Chemical control enhancement: Development of lspA inhibitors as agricultural bactericides represents a novel approach with potentially lower environmental impact than traditional copper-based compounds. These inhibitors could be applied as seed treatments, foliar sprays, or systemic agents, potentially at lower doses than conventional bactericides due to the essential nature of the lspA target.

  • Resistance breeding augmentation: Understanding the interaction between lspA-processed lipoproteins and plant immunity can inform breeding programs focused on enhancing XA21-mediated and other resistance mechanisms. Specific lipoprotein patterns processed by lspA may serve as molecular signatures that can be targeted by novel plant resistance genes.

  • Biological control synergy: Biocontrol agents containing Bacillus subtilis or Bacillus amyloliquefaciens, which are already used preventively against Xanthomonas infections, could be enhanced or selected for production of compounds that specifically inhibit lspA activity . These antagonistic bacteria could be applied in combination with other management practices for additive or synergistic effects.

  • Diagnostic tool development: Knowledge of lspA sequence variation across Xanthomonas oryzae pv. oryzae strains can enable development of molecular diagnostic tools for rapid identification of specific pathogen variants in the field, allowing for precise and timely intervention strategies tailored to the exact pathogen population present.

  • Cultural practice optimization: Understanding how environmental conditions affect lspA activity and subsequent bacterial virulence can inform modifications to irrigation schedules, planting density, and fertilization practices. For example, since overhead irrigation spreads bacterial leaf spot diseases , alternative irrigation methods could be particularly effective at reducing transmission of pathogens dependent on lspA-processed virulence factors.

An integrated approach combining these strategies with existing practices like crop rotation, field sanitation, and judicious use of resistant varieties offers the most promising pathway for sustainable management of bacterial blight in rice. The molecular specificity of targeting lspA provides opportunities for precision disease management with potentially reduced environmental impact compared to broad-spectrum bactericides .

What methodologies can researchers use to screen for novel inhibitors of Xanthomonas oryzae pv. oryzae lspA?

Researchers can employ a diverse array of methodologies to screen for novel inhibitors of Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA), ranging from high-throughput biochemical assays to sophisticated whole-cell approaches:

  • Fluorogenic substrate-based high-throughput screening:

    • Development of FRET-based substrates containing the consensus lipobox sequence with flanking fluorophore-quencher pairs

    • Miniaturization to 384 or 1536-well format for screening large compound libraries

    • Monitoring real-time enzymatic activity through fluorescence intensity measurement

    • Secondary dose-response confirmation of hit compounds

  • Structure-guided virtual screening:

    • Homology modeling of X. oryzae pv. oryzae lspA based on available bacterial lspA crystal structures

    • Molecular docking of virtual compound libraries targeting the active site or allosteric sites

    • Pharmacophore-based screening focusing on essential features of known lspA inhibitors

    • Molecular dynamics simulations to evaluate binding stability of virtual hits

  • Whole-cell phenotypic screening:

    • Reporter strains of X. oryzae pv. oryzae with fluorescent or luminescent markers linked to envelope stress responses

    • Growth inhibition assays under conditions that specifically sensitize bacteria to lspA inhibition

    • Membrane permeability assays using fluorescent dyes to detect envelope integrity disruption

    • Complementation systems with controlled lspA expression for target validation

  • Activity-based protein profiling:

    • Development of mechanism-based probes that specifically label active lspA

    • Competition assays to identify compounds that prevent probe labeling

    • In situ profiling in bacterial membrane preparations to account for native enzyme environment

    • Mass spectrometry analysis to confirm target engagement and selectivity

  • Lipidated peptide library screening:

    • Synthesis of diverse peptide libraries containing the lipobox motif with various modifications

    • Competition assays against known substrates to identify inhibitory peptide scaffolds

    • Structure-activity relationship analysis to optimize lead peptide inhibitors

    • Conversion of substrate mimetics to non-cleavable transition state analogs

A particularly effective integrated workflow combines initial high-throughput screening of diverse chemical libraries using fluorogenic substrates, followed by hit validation in whole-cell assays, and subsequent medicinal chemistry optimization guided by structure-activity relationships and molecular modeling. This approach balances the efficiency of biochemical screening with the physiological relevance of cell-based assays .

How might genetic variation in lspA across Xanthomonas strains impact the effectiveness of targeted control strategies?

Genetic variation in lipoprotein signal peptidase (lspA) across different Xanthomonas strains presents significant implications for the development and effectiveness of targeted control strategies:

  • Sequence diversity and inhibitor efficacy: Comparative genomic analyses of various Xanthomonas species and strains reveal polymorphisms in the lspA coding sequence that could affect binding site architecture and enzyme kinetics. Studies on bacterial leaf spot in pepper have shown considerable genetic diversity among Xanthomonas populations, with multiple races identified (P1, P3, P4, and P6) having different virulence characteristics . This diversity could translate to variations in lspA structure that affect inhibitor binding affinity and specificity, potentially requiring the development of broad-spectrum inhibitors or region-specific control strategies.

  • Evolutionary pressure and resistance development: Targeting lspA for disease control creates selective pressure that may accelerate the evolution of resistance. Xanthomonas species demonstrate considerable genomic plasticity, as evidenced by the phase variation observed in LPS O-antigen biosynthetic gene clusters . Similar mechanisms could potentially affect lspA, leading to reversible genetic changes that alter enzyme expression or structure in response to selection pressure from inhibitors.

  • Horizontal gene transfer considerations: The exchange of genetic material between different Xanthomonas strains through horizontal gene transfer could spread resistance mechanisms or variant lspA alleles. This genomic fluidity must be considered when designing control strategies to ensure durable effectiveness against diverse and evolving pathogen populations.

  • Race-specific virulence patterns: The distribution of different Xanthomonas races varies geographically and temporally. For example, in southwest Florida pepper fields, researchers identified a distribution of 42% race P1, 26% race P6, 24% race P3, and 8% race P4 Xanthomonas strains . These population dynamics likely reflect different evolutionary trajectories that could extend to variation in essential enzymes like lspA, necessitating surveillance programs to monitor pathogen diversity and adjust control strategies accordingly.

  • Cross-species applicability: While lspA is conserved across Xanthomonas species, sufficient sequence divergence exists to potentially limit the cross-species efficacy of highly specific inhibitors. Control strategies must balance specificity against the desired spectrum of activity, particularly in agricultural settings where multiple Xanthomonas species may co-occur or affect rotation crops.

Addressing these challenges requires integrated approaches combining genomic surveillance of pathogen populations, structure-activity relationship studies of inhibitors against variant lspA enzymes, and resistance management strategies that minimize selective pressure while maintaining effective disease control .

What CRISPR-based approaches can be used to study lspA function in Xanthomonas oryzae pv. oryzae?

CRISPR-based technologies offer powerful approaches for investigating lipoprotein signal peptidase (lspA) function in Xanthomonas oryzae pv. oryzae, enabling precise genetic manipulation and functional characterization:

  • Genome editing for functional analysis:

    • CRISPR-Cas9 can be adapted for targeted knockout of lspA to establish its essentiality and phenotypic consequences

    • CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) allows for tunable repression of lspA expression without complete gene deletion, enabling study of partial loss-of-function phenotypes

    • CRISPR activation (CRISPRa) systems can upregulate lspA expression to examine effects of overexpression on lipoprotein processing and bacterial physiology

    • Base editors or prime editors permit introduction of specific point mutations to study structure-function relationships without disrupting the entire gene

  • High-throughput functional genomics:

    • CRISPR-based screens using pooled sgRNA libraries targeting genes in lipoprotein processing pathways can identify genetic interactions with lspA

    • CRISPRi screens in the presence of sublethal concentrations of lspA inhibitors can reveal compensatory mechanisms or synthetic lethal interactions

    • Dual CRISPRi/CRISPRa approaches can map the regulatory networks controlling lspA expression under various environmental conditions relevant to plant infection

  • In vivo dynamics and localization:

    • CRISPR-mediated knock-in of fluorescent protein tags allows visualization of lspA subcellular localization during infection processes

    • Nanobody-based CRISPRainbow systems enable multiplexed imaging of lspA alongside substrate lipoproteins to track processing dynamics

    • Optogenetic control elements integrated with CRISPR systems permit temporal control of lspA expression to study kinetics of lipoprotein maturation

  • Host-pathogen interaction analysis:

    • CRISPR editing of both pathogen (lspA variants) and host (immunity components) creates isogenic lines for precise dissection of recognition mechanisms

    • CRISPRi modulation of lspA in planta during infection can reveal stage-specific requirements for lipoprotein processing

    • Multiplexed CRISPR targeting of lspA alongside virulence-associated genes can untangle complex relationships between lipoprotein processing and pathogenicity

Implementation challenges include developing efficient transformation protocols for Xanthomonas oryzae pv. oryzae, optimizing CRISPR component expression, and ensuring specificity to avoid off-target effects. These approaches promise to deliver unprecedented insights into lspA biology and potential applications for disease management .

How can structural biology approaches advance our understanding of lspA catalytic mechanisms?

Advanced structural biology approaches can significantly deepen our understanding of Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) catalytic mechanisms, providing atomic-level insights crucial for both fundamental knowledge and inhibitor development:

  • Cryo-electron microscopy (Cryo-EM):

    • Single-particle cryo-EM can resolve the structure of membrane-embedded lspA in near-native conditions without crystallization

    • Lipid nanodisc reconstitution of lspA allows visualization of the enzyme in a lipid bilayer environment

    • Time-resolved cryo-EM with substrate analogs can capture conformational changes during the catalytic cycle

    • Subtomogram averaging of lspA in bacterial membrane extracts can reveal native interactions with other membrane components

  • Advanced X-ray crystallography techniques:

    • Lipidic cubic phase crystallization can enable structure determination of lspA in a membrane-mimetic environment

    • Microcrystallography at X-ray free-electron lasers (XFELs) allows collection of diffraction data from microcrystals without radiation damage

    • Serial synchrotron crystallography with multiple substrate-bound and inhibitor-bound states can map the binding pocket dynamics

    • Neutron crystallography can precisely locate hydrogen atoms crucial for understanding the protonation states in the catalytic mechanism

  • Integrated NMR spectroscopy approaches:

    • Solid-state NMR of isotopically labeled lspA can provide dynamics information within the membrane environment

    • Solution NMR of detergent-solubilized lspA can characterize protein-substrate interactions and conformational changes

    • Relaxation dispersion and chemical exchange saturation transfer (CEST) experiments can identify transient states in the catalytic cycle

    • Paramagnetic relaxation enhancement (PRE) measurements with spin-labeled substrates can map the substrate binding pathway

  • Computational and hybrid methods:

    • Molecular dynamics simulations based on structural data can model substrate binding and catalytic mechanisms in atomic detail

    • Quantum mechanics/molecular mechanics (QM/MM) calculations can elucidate the energetics of bond breaking and formation during catalysis

    • AlphaFold2 or RoseTTAFold structural predictions can be integrated with experimental data to model regions not resolved in experimental structures

    • Integrative modeling combining data from multiple experimental techniques (cryo-EM, crystallography, SAXS, crosslinking mass spectrometry) can generate comprehensive structural models

These approaches can specifically address key mechanistic questions such as how lspA achieves selectivity for lipid-modified substrates, the exact roles of the catalytic aspartate residues, conformational changes during substrate binding and product release, and the molecular basis for inhibitor specificity. Such insights will facilitate structure-based design of selective inhibitors and engineering of lspA variants with modified properties for biotechnological applications .

What are the emerging applications of recombinant Xanthomonas oryzae pv. oryzae lspA in biotechnology and synthetic biology?

Recombinant Xanthomonas oryzae pv. oryzae lipoprotein signal peptidase (lspA) holds significant potential for innovative applications in biotechnology and synthetic biology, extending beyond its native role in bacterial physiology:

  • Protein engineering and biocatalysis:

    • Development of engineered lspA variants with altered substrate specificity for selective processing of designer lipoproteins

    • Creation of thermostable or solvent-tolerant lspA mutants for industrial biocatalysis applications

    • Incorporation of lspA into multi-enzyme cascades for one-pot synthesis of lipid-modified proteins with pharmaceutical applications

    • Evolution of lspA to recognize non-canonical amino acids or lipid moieties, expanding the toolkit for protein modification

  • Synthetic biology circuit components:

    • Integration of lspA-based processing into genetic circuits as regulated proteolytic modules for conditional protein activation or inactivation

    • Development of bistable switches utilizing reversible lspA expression to control membrane protein composition and cellular properties

    • Creation of biosensors where lspA activity is coupled to reporter systems for detecting environmental signals or bacterial pathogens

    • Engineering orthogonal lipoprotein processing pathways in non-native hosts for compartmentalized protein localization

  • Biotechnological applications:

    • Production of anchored enzyme displays on bacterial surfaces for biocatalysis, bioremediation, or biosensing applications

    • Development of self-assembling lipoprotein-based nanostructures through controlled lspA processing

    • Creation of vesicle-based drug delivery systems with lipoprotein targeting moieties processed by recombinant lspA

    • Engineering bacterial membrane vesicles with defined lipoprotein content for vaccine development

  • Agricultural biotechnology applications:

    • Development of genetically modified probiotics expressing altered lspA variants that can outcompete pathogenic Xanthomonas in the phyllosphere

    • Creation of trap crops expressing lspA inhibitors under pathogen-inducible promoters

    • Engineering of biocontrol agents that interfere with pathogen lipoprotein processing through secreted inhibitors or competitive substrate mimics

    • Development of diagnostic tools based on fluorogenic lspA substrates for rapid detection of Xanthomonas infections in field settings

These emerging applications leverage the unique properties of lspA as a membrane-bound protease with high specificity for lipid-modified substrates, creating opportunities at the intersection of protein engineering, synthetic biology, and agricultural biotechnology. The continued development of expression and purification protocols for recombinant lspA, as discussed in section 2, will facilitate these diverse applications by providing access to well-characterized enzyme variants with tailored properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.