Recombinant Xanthomonas oryzae pv. oryzae Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Xanthomonas oryzae pv. oryzae is a Gram-negative bacterium that causes bacterial blight in rice plants . Recombinant Xanthomonas oryzae pv. oryzae Monofunctional biosynthetic peptidoglycan transglycosylase (MtgA), also known as peptidoglycan glycosyltransferase (PGT), is an enzyme involved in peptidoglycan biosynthesis. Peptidoglycan is a crucial component of bacterial cell walls, providing structural integrity . MtgA catalyzes the formation of β(1→4) glycosidic linkages between disaccharide units during peptidoglycan biosynthesis .

Structure and Function

MtgA is a glycan polymerase that elongates glycan chains from lipid-linked precursors. It belongs to the glycosyltransferase 51 family. The protein is located in the cell's inner membrane and acts as a single-pass membrane protein. The target protein sequence of MtgA in Xanthomonas oryzae pv. oryzae (strain MAFF 311018) is represented by the Uniprot No. Q2P4R3.

Synonyms

MtgA is also known by several other names:

  • XOO1709

  • Biosynthetic peptidoglycan transglycosylase

  • Glycan polymerase

  • Peptidoglycan glycosyltransferase MtgA

  • PGT

Role in Peptidoglycan Biosynthesis

Peptidoglycan biosynthesis is essential for bacterial cell wall integrity . The process involves multiple enzymes, including peptidoglycan glycosyltransferases (PGTs) like MtgA . These enzymes catalyze the final steps in peptidoglycan synthesis, forming glycosidic linkages between disaccharide units .

MtgA as a Target for Antimicrobials

Given the importance of peptidoglycan in bacterial survival, enzymes like MtgA are potential targets for developing antimicrobial agents . Inhibiting MtgA can disrupt peptidoglycan synthesis, compromising bacterial cell wall integrity and leading to cell death .

Relevance to Pathogenicity

Xanthomonas oryzae pv. oryzae causes bacterial blight, a disease impacting rice production . Disrupting peptidoglycan biosynthesis via MtgA inhibition could reduce the pathogen's ability to maintain cell integrity, thus reducing its virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; XOO1709; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Target Names
mtgA
Target Protein Sequence
MGTDVWDDKQAAPPRRRRCLRWVLAAPLLFAAASVLQVLFLRVVDPPISSMMVGRYLEAW GEGDWSFSLHQRWRDYDKIAASLPISVVAAEDQQFPMHHGFDLQAIEKARDHNARGGRVR GASTISQQVAKNVFLWQGRSWVRKGLEAWYTVLIELFWPKQRILEMYLNVAEFGDGVYGA QAAAQQFWGKDAAGLSPTESARLAAVLPSPRHYDARSPGAFVQRRTMWIQRQARQLGGPA YLPAP
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links

KEGG: xom:XOO1709

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of mtgA in bacterial cell wall biosynthesis?

Monofunctional peptidoglycan glycosyltransferase (mtgA) catalyzes glycan chain elongation of the bacterial cell wall, a crucial process for bacterial survival and growth. Unlike bifunctional PBPs (Penicillin Binding Proteins), mtgA possesses only glycosyltransferase activity without transpeptidase function. In E. coli, mtgA has been demonstrated to interact with divisome proteins and localize at the division site under specific conditions, suggesting its involvement in peptidoglycan synthesis during cell division . When studying mtgA from X. oryzae pv. oryzae, researchers should consider its potentially similar role in cell wall assembly, while recognizing possible species-specific variations in function or regulation.

The activity of mtgA can be assessed in vitro using substrates like GlcNAc-labeled lipid II, with products analyzed by chromatographic separation. In one study with E. coli, GFP-tagged mtgA showed 2.4-fold increased peptidoglycan polymerization compared to controls, and the polymerized material was completely digested by lysozyme, confirming its glycosyltransferase activity .

How can the mtgA gene be cloned from X. oryzae pv. oryzae?

Cloning the mtgA gene from X. oryzae pv. oryzae requires careful primer design and consideration of sequence conservation. Researchers can employ degenerate primers designed based on conserved regions in related Xanthomonas species. The CODEHOP (consensus-degenerate hybrid oligonucleotide primers) approach has been successfully used for amplifying genes from X. oryzae pv. oryzae based on sequences from X. campestris pv. campestris and X. axonopodis pv. citri .

For recombinant expression, the amplified mtgA gene can be cloned into appropriate expression vectors. When working with X. oryzae pv. oryzae genes, it's beneficial to use vectors like pCR-Blunt II-TOPO for initial cloning steps before transferring to expression vectors. Growth and manipulation protocols should follow standard practices for X. oryzae pv. oryzae, including cultivation at 28°C in appropriate media such as peptone sucrose (PS) medium .

What growth conditions are optimal for studying mtgA expression in X. oryzae pv. oryzae?

To minimize experimental variables, particularly when studying iron-responsive genes (which might cross-regulate with cell wall biosynthesis genes in some bacteria), use MilliQ water and acid-washed glassware to control exogenous iron contamination . For gene expression studies, cultures can be grown to mid-log phase (OD600 of approximately 0.5) before applying experimental treatments, as this approach has been successfully used for studying gene expression in X. oryzae pv. oryzae .

How does mtgA protein localize in X. oryzae pv. oryzae cells?

Based on studies in E. coli, mtgA localizes at the division site under specific genetic conditions, particularly in strains deficient in PBP1b and expressing thermosensitive PBP1a . To study mtgA localization in X. oryzae pv. oryzae, fluorescent protein fusion approaches can be employed similar to the GFP-mtgA fusion strategy used in E. coli studies.

Researchers should design constructs where mtgA is fused to a fluorescent reporter like GFP, ensuring the fusion preserves protein function. The functionality of fusion proteins should be verified through complementation assays in mtgA mutants and in vitro activity assays. For localization studies, fluorescence microscopy with appropriate controls is essential. Comparative studies examining localization under different growth conditions or in various genetic backgrounds (such as strains with mutations in peptidoglycan synthesis genes) can provide insights into functional interactions of mtgA in X. oryzae pv. oryzae.

What methods can be used to generate and confirm mtgA mutants in X. oryzae pv. oryzae?

Several strategies can be employed to generate mtgA mutants in X. oryzae pv. oryzae:

  • Homologous recombination using suicide vectors: This approach involves cloning an internal fragment of the mtgA gene into a suicide vector like pK18mob. The construct is then transferred to X. oryzae pv. oryzae via biparental mating using donor strains like E. coli S17-1. Integration of the plasmid disrupts the target gene .

  • Transcriptional reporter fusions: Combining gene disruption with reporter gene insertion allows simultaneous gene inactivation and expression analysis. Vectors like pVO155 carrying a promoterless gusA gene can be used for this purpose .

For confirmation of mutants, PCR verification using primers that bind to genomic regions flanking the insertion site, combined with vector-specific primers, can confirm proper integration. Sequencing of PCR products provides additional validation. Phenotypic characterization should include growth curve analysis, microscopic examination of cell morphology, and specific assays for cell wall integrity .

How does mtgA activity in X. oryzae pv. oryzae affect pathogenicity on rice?

To investigate the role of mtgA in X. oryzae pv. oryzae pathogenicity, researchers should compare wild-type and mtgA mutant strains in standardized virulence assays on rice plants. While direct evidence for mtgA's role in X. oryzae pv. oryzae virulence is not presented in the search results, methodological approaches can be adapted from studies of other virulence factors.

The experimental design should include:

  • Plant inoculation assays with precise quantification of disease symptoms

  • Bacterial population dynamics studies in planta

  • Analysis of potential alterations in cell wall structure that might affect pathogen recognition by host immune systems

  • Complementation experiments with the wild-type mtgA gene to confirm phenotype specificity

Given that cell wall modifications can affect many aspects of bacterial physiology, researchers should examine both direct pathogenicity effects and potential indirect consequences of mtgA mutation, such as altered stress resistance or changes in growth rate that could impact virulence.

How do protein-protein interactions between mtgA and divisome components function in X. oryzae pv. oryzae?

In E. coli, mtgA interacts with multiple divisome proteins including PBP3, FtsW, and FtsN, suggesting it functions within a protein complex during cell division . To investigate similar interactions in X. oryzae pv. oryzae, researchers can employ several complementary approaches:

  • Bacterial two-hybrid systems: The adenylate cyclase-based bacterial two-hybrid system has successfully detected interactions between mtgA and divisome proteins in E. coli. This approach can be adapted for X. oryzae pv. oryzae proteins by cloning the corresponding genes into appropriate vectors .

  • Co-immunoprecipitation: Using antibodies against mtgA or epitope-tagged versions of the protein to pull down interaction partners.

  • Fluorescence microscopy co-localization: Dual-labeled strains with differently colored fluorescent proteins fused to mtgA and potential interaction partners can reveal spatial and temporal coordination during cell division.

  • Biochemical complex isolation: Using techniques like blue native PAGE or size exclusion chromatography to isolate native protein complexes containing mtgA.

The experimental design should consider the dynamic nature of divisome assembly and the potential transience of some interactions. Controls should include known non-interacting proteins and, when possible, mutations in interaction interfaces to confirm specificity.

What is the impact of horizontal gene transfer and recombination on mtgA evolution in Xanthomonas species?

While specific information about mtgA evolution in X. oryzae pv. oryzae is not provided in the search results, the significant impact of recombination on Xanthomonas evolution is well-documented. In X. perforans, core genome multilocus sequence analysis revealed extensive recombination affecting both core genes and pathogenicity-associated genes .

To study mtgA evolution in Xanthomonas species, researchers should:

  • Perform phylogenetic analysis of mtgA sequences from diverse Xanthomonas isolates, including multiple strains of X. oryzae pv. oryzae.

  • Calculate the relative impact of recombination to mutation on nucleotide substitution using tools like ClonalFrameML .

  • Examine gene neighborhoods and flanking regions for evidence of horizontal transfer, including plasmid, phage, and transposable element signatures .

  • Analyze sequence conservation patterns, particularly in functional domains, to identify regions under selection.

  • Compare mtgA gene trees with species phylogeny to identify potential instances of horizontal gene transfer.

What in vitro systems can be developed to study recombinant X. oryzae pv. oryzae mtgA enzymatic activity?

Developing robust in vitro systems to study mtgA enzymatic activity requires careful consideration of protein purification, substrate preparation, and assay conditions. Based on approaches used for E. coli mtgA , researchers can establish the following methodology:

  • Protein expression and purification: Express recombinant mtgA with appropriate affinity tags (His6, for example) and optimize purification to obtain active enzyme. Consider both full-length and transmembrane domain-truncated versions to improve solubility.

  • Substrate preparation: Synthesize or isolate labeled lipid II substrates. In E. coli studies, GlcNAc-labeled lipid II was used successfully .

  • Reaction conditions optimization:

ParameterRange to TestNotes
pH6.5-8.0Test in 0.5 unit increments
Buffer systemHEPES, MES, Phosphate50-100 mM concentration
Divalent cationsCa2+, Mg2+5-20 mM, essential for activity
DetergentsDecyl-PEG, CHAPS, DDMCritical for membrane protein activity
Temperature25-37°CX. oryzae optimal growth is 28°C
  • Product analysis: Separate reaction products by thin-layer chromatography or HPLC, with confirmation by mass spectrometry. Verify that products are sensitive to lysozyme digestion, confirming their glycan nature .

  • Kinetic characterization: Determine Km, Vmax, and the effects of potential inhibitors, which provides valuable information for structure-function studies.

This in vitro system can be used to compare wild-type mtgA with site-directed mutants, offering insights into catalytic mechanism and specificity determinants.

How can transcriptional regulation of mtgA in X. oryzae pv. oryzae be characterized under different environmental conditions?

Understanding transcriptional regulation of mtgA requires comprehensive analysis under various conditions relevant to the bacterial lifecycle. Based on approaches used for studying gene regulation in X. oryzae pv. oryzae , researchers can employ the following strategies:

  • Transcriptional reporter fusions: Create mtgA promoter fusions to reporter genes like gusA (β-glucuronidase) or gfp (green fluorescent protein). This approach has been successfully used to study gene expression in X. oryzae pv. oryzae .

  • RT-PCR and qRT-PCR analysis: Isolate total RNA from X. oryzae pv. oryzae grown under different conditions, treat with DNase I to remove DNA contamination, and perform reverse transcription followed by PCR or quantitative PCR .

  • RNA-Seq: For genome-wide context, perform transcriptome analysis to identify coregulated genes and potential regulatory networks.

Conditions to test should include:

ConditionRelevanceImplementation
Growth phaseCell division dynamicsSample at early log, mid-log, late log, and stationary phases
Nutrient limitationStress responseMinimal medium with limited carbon or nitrogen
Plant extract exposureHost environment simulationAddition of rice leaf extract to culture
Cell wall stressFunctional contextSub-inhibitory concentrations of β-lactams or lysozyme
Temperature shiftsEnvironmental adaptationGrowth at 20°C, 28°C, and 37°C
  • Promoter dissection: Create a series of promoter deletions to identify regulatory elements, followed by electrophoretic mobility shift assays (EMSA) to confirm protein-DNA interactions.

  • Regulator identification: Perform transposon mutagenesis or construct deletion mutants of candidate regulators and assess impacts on mtgA expression.

This multifaceted approach can reveal how X. oryzae pv. oryzae regulates mtgA expression in response to environmental cues, providing insights into its physiological role.

How can structural biology approaches be applied to understand the mechanism of X. oryzae pv. oryzae mtgA?

Advanced structural biology techniques can provide crucial insights into mtgA's catalytic mechanism and protein-protein interactions. Researchers should consider the following approaches:

  • X-ray crystallography: Express, purify, and crystallize mtgA for structure determination. This may require modifications such as removal of flexible regions or creation of fusion proteins to aid crystallization. The resulting structures can reveal the catalytic site architecture and potential binding interfaces.

  • Cryo-electron microscopy (Cryo-EM): Particularly valuable for examining mtgA in the context of larger multiprotein complexes, such as its associations with divisome components.

  • Nuclear Magnetic Resonance (NMR): For studying protein dynamics and specific binding interactions, especially for smaller domains of mtgA.

  • Molecular dynamics simulations: Computational approaches to model protein flexibility, substrate binding, and the catalytic process, building on experimental structural data.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of conformational change upon substrate binding or protein-protein interactions.

These structural approaches should be combined with site-directed mutagenesis of predicted catalytic and interaction residues, followed by functional assays to correlate structure with function. The integration of structural biology with biochemical and cellular analyses can provide a comprehensive understanding of mtgA's molecular mechanism.

What are the challenges and solutions in developing high-throughput screening systems for inhibitors of X. oryzae pv. oryzae mtgA?

Developing high-throughput screening (HTS) systems for mtgA inhibitors presents several technical challenges that require innovative solutions:

  • Assay development: Traditional transglycosylase assays using radiolabeled substrates are not suitable for HTS. Alternative approaches include:

    • Fluorescence-based assays using dansylated or fluorescein-labeled lipid II

    • FRET-based detection systems for monitoring polymerization

    • Malachite green assays for detecting pyrophosphate release during transglycosylation

  • Purified protein stability: Membrane proteins like mtgA often show limited stability in solution. Stability can be improved through:

    • Optimal detergent selection through systematic screening

    • Addition of specific lipids that enhance stability

    • Engineering thermostabilized variants through directed evolution

    • Using nanodiscs or liposomes to provide a lipid bilayer environment

  • Substrate availability: Lipid II is complex and expensive to synthesize. Solutions include:

    • Developing simplified substrate analogs that retain recognition by mtgA

    • Establishing partnerships with specialized chemical biology laboratories

    • Optimizing enzymatic synthesis routes for lipid II production

  • Assay miniaturization: Adapting protocols to 384- or 1536-well formats while maintaining signal-to-noise ratios requires:

    • Optimization of enzyme and substrate concentrations

    • Selection of detection systems with appropriate sensitivity

    • Rigorous statistical validation of assay performance (Z' factor determination)

  • Distinguishing specific inhibitors: Counter-screening against other glycosyltransferases helps identify mtgA-specific compounds versus general-acting molecules.

This HTS platform would enable the identification of chemical probes for studying mtgA function and potentially lead to new antimicrobial strategies targeting X. oryzae pv. oryzae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.