Recombinant Xanthomonas oryzae pv. oryzae Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; XOO3622; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Target Names
kdpC
Target Protein Sequence
MSSSLPLRDDGALRGSLMLAVFTLFGLGLAYSLVATGITGALFSEQATGSLVRVDARVVG SALVAQPFTDARYFQPRPSAAKYDLTAASGSNQARSNPDLLARIAATRAQVAKRDGIAPE AVPGELLTQSGSGLDPHLSPAGAQVQIRRVAAARGLPEQRVAALVQAATEAPQFGLLGQP RVNVLALNLALDKAGNGESGRDNGVKQAY
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: xom:XOO3622

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of KdpC in the KdpFABC complex of Xanthomonas oryzae pv. oryzae?

KdpC functions as an essential component of the KdpFABC complex, which serves as a high-affinity potassium transport system in Xanthomonas oryzae pv. oryzae. The KdpFABC complex demonstrates remarkable stability across different states during the potassium transport cycle, with KdpC showing particularly consistent positioning. Structural analysis reveals that KdpC remains immobile during conformational changes in the transport cycle, contradicting previous assumptions about its potential gating function . This stability suggests that KdpC likely plays a structural role in maintaining the integrity of the complex rather than directly participating in the dynamic aspects of potassium transport.

How does the KdpFABC complex contribute to bacterial virulence?

The KdpFABC complex contributes to bacterial virulence by enabling survival under potassium-limited conditions, which bacteria frequently encounter in plant host environments. While not directly characterized as a virulence factor in the same manner as type III secretion systems, the KdpFABC complex provides essential physiological support for bacterial growth during infection. Research indicates that potassium homeostasis is interconnected with regulatory systems that control virulence, such as the PhoPQ two-component system in Xanthomonas oryzae pv. oryzae . The PhoPQ system has been demonstrated to influence virulence partly through regulation of HrpG, a response regulator involved in controlling type III secretion system expression . This suggests that proper potassium homeostasis, facilitated by the KdpFABC complex, may indirectly affect virulence gene expression.

How does the structural relationship between KdpC and other components of the complex influence potassium transport?

Recent cryo-EM structural studies reveal that KdpC maintains a stable position relative to other components during the transport cycle . Rather than functioning in a dynamic gating capacity as previously hypothesized, KdpC appears to provide structural support for the complex. The actual potassium transport pathway involves a horizontal tunnel that begins at the selectivity filter in KdpA, extends into the transmembrane domain, and connects to a tunnel linking KdpA and KdpB . This pathway differs significantly from other structurally related potassium transport systems, which typically feature a water-filled vestibule facilitating potassium flux. The tunnels connecting components of the complex vary in length and diameter between different conformational states, indicating that structural transitions throughout the complex, rather than movements of KdpC specifically, regulate potassium transport activity .

What are the optimal conditions for expressing recombinant KdpC from Xanthomonas oryzae pv. oryzae?

For optimal expression of recombinant KdpC from Xanthomonas oryzae pv. oryzae, researchers should consider the following protocol based on established methods for membrane proteins from this organism:

  • Expression System Selection: Escherichia coli is typically the preferred expression system, with BL21(DE3) or similar strains designed for membrane protein expression being most suitable.

  • Growth Conditions: Culture bacteria in either peptone sucrose (PS) medium or a modified M9 minimal medium at 28°C for Xanthomonas-derived constructs . For E. coli expression systems, standard Luria-Bertani (LB) medium at 37°C is appropriate, with temperature reduction to 18-20°C upon induction.

  • Induction Parameters: Induce protein expression at mid-log phase (OD600 = 0.6-0.8) with IPTG concentrations between 0.1-0.5 mM, with lower concentrations often yielding better results for membrane proteins.

  • Co-expression Considerations: For functional studies, consider co-expressing KdpC with other components of the KdpFABC complex, as the stability and proper folding of KdpC may depend on interactions with partner proteins.

  • Antibiotic Selection: When using plasmid-based expression systems, appropriate antibiotics should be included: kanamycin (50 μg/ml), spectinomycin (50 μg/ml), ampicillin (100 μg/ml), or gentamicin (25 μg/ml for E. coli, 15 μg/ml for Xanthomonas) .

What experimental approaches are most effective for studying KdpC function and its role in the KdpFABC complex?

The most effective experimental approaches for studying KdpC function combine genetic, biochemical, and structural methods:

  • Gene Knockout Studies: Generate a kdpC knockout strain to evaluate phenotypic changes in potassium uptake capacity and virulence. This approach allows assessment of KdpC's contribution to bacterial fitness and pathogenicity, following similar methodologies employed for studying other regulatory components in Xanthomonas oryzae pv. oryzae .

  • Site-Directed Mutagenesis: Introduce specific mutations in conserved residues of KdpC to identify amino acids critical for complex assembly or function.

  • Protein-Protein Interaction Studies: Employ techniques such as bacterial two-hybrid assays, co-immunoprecipitation, or crosslinking studies to map interactions between KdpC and other components of the complex.

  • Structural Analysis: Cryo-EM has proven particularly valuable for resolving structures of the KdpFABC complex in different conformational states . Complementary approaches include:

    • EPR spectroscopy to measure distances between specific labeled residues during conformational changes

    • X-ray crystallography for high-resolution static structures

    • Molecular dynamics simulations to model dynamic aspects of the complex

  • Functional Reconstitution: Reconstitute purified KdpFABC complex containing KdpC into liposomes to measure potassium transport activity in a controlled system.

What statistical considerations should be addressed when designing experiments involving KdpC?

When designing experiments involving KdpC, researchers should adhere to these statistical and experimental design principles:

  • Replication Requirements: Implement true biological replicates rather than technical replicates alone. For gene expression studies, a minimum of three biological replicates is recommended to account for natural biological variation .

  • Randomization Strategy: Employ proper randomization procedures to eliminate systematic bias. This is particularly important when comparing wildtype and kdpC mutant strains across multiple experimental conditions .

  • Blocking Techniques: Implement blocking to control for known sources of variability. For example, when conducting growth experiments over multiple days or with different batches of media, use a randomized complete block design (RCBD) rather than a completely randomized design (CRD) .

  • Sample Size Determination: Conduct power analysis before initiating experiments to ensure sufficient statistical power for detecting biologically relevant differences. Consider:

    • Expected effect size based on preliminary data

    • Desired significance level (typically α = 0.05)

    • Desired statistical power (typically 0.8 or higher)

    • Variability in the measured response variables

  • Data Analysis Approach: Select appropriate statistical tests based on experimental design and data distribution. For comparing multiple strains across different conditions, consider two-way ANOVA followed by appropriate post-hoc tests .

  • Experimental Unit Definition: Clearly define the experimental unit, particularly when working with bacterial cultures where pseudoreplication (treating subsamples as independent replicates) can lead to invalid statistical inferences .

How does the KdpFABC complex interact with other regulatory systems in Xanthomonas oryzae pv. oryzae?

The KdpFABC complex in Xanthomonas oryzae pv. oryzae interacts with multiple regulatory systems, creating a complex network that integrates potassium homeostasis with virulence regulation:

  • Two-Component Systems: Research indicates potential crosstalk between the KdpFABC system and two-component systems like PhoPQ and RaxRH. The PhoPQ system regulates virulence in X. oryzae pv. oryzae, partly through control of HrpG, which influences type III secretion system expression . Given that potassium limitation is a signal that bacteria encounter during infection, the KdpFABC system likely communicates with these regulatory systems to coordinate adaptive responses.

  • c-di-GMP Signaling Pathways: PilZ domain proteins functioning in c-di-GMP signaling pathways have been shown to regulate virulence and motility in X. oryzae pv. oryzae . The relationship between potassium transport and c-di-GMP signaling represents an important area for investigation, as both systems influence bacterial adaptation to host environments.

  • Potential Integration Table:

Regulatory SystemPrimary FunctionPotential Interaction with KdpFABCResearch Methodology
PhoPQ TCSVirulence regulation, HrpG activationMay respond to K+ limitation signalsTranscriptomics of phoP/Q mutants under K+ limitation
RaxRH TCSCell density sensing, rax gene regulationCould coordinate K+ uptake with population densityAnalysis of kdpFABC expression in raxR knockout strain
c-di-GMP/PilZBiofilm formation, motility, virulenceMay synchronize K+ homeostasis with biofilm statusExamination of KdpFABC activity in PilZ domain protein mutants
HrpG/HrpXT3SS regulationK+ transport may influence hrp gene expressionMonitoring hrp gene expression in kdpC mutants

Understanding these interactions requires integrated approaches combining transcriptomics, proteomics, and targeted genetic studies to map the signaling networks connecting potassium homeostasis with virulence regulation.

What structural features distinguish KdpC in Xanthomonas oryzae pv. oryzae from KdpC in other bacterial species?

Although detailed structural information specific to X. oryzae pv. oryzae KdpC is limited in the provided search results, comparative analysis with KdpC structures from other bacterial species reveals several important considerations:

  • Structural Conservation: Cryo-EM studies of KdpFABC complexes demonstrate that KdpC maintains a relatively immobile position during the transport cycle, suggesting structural conservation of this function across bacterial species .

  • Species-Specific Adaptations: While the core function of KdpC appears conserved, species-specific adaptations may exist, particularly in:

    • Surface-exposed regions that might interact with species-specific regulatory proteins

    • Interface regions between KdpC and other components of the complex

    • Post-translational modification sites that could be targets for species-specific regulatory systems

  • Structural Analysis Approaches: To identify these distinguishing features, researchers should consider:

    • Comparative sequence analysis to identify conserved and variable regions

    • Homology modeling based on existing KdpFABC structures

    • Structural studies using cryo-EM or X-ray crystallography specifically targeting the X. oryzae pv. oryzae complex

  • Functional Implications: Structural differences may correlate with functional adaptations to the specific environmental niches and host interactions of X. oryzae pv. oryzae compared to other bacterial species.

How do experimental data on KdpC function reconcile with contradicting observations in the literature?

Researchers working with KdpC may encounter contradicting observations in the literature, requiring careful analysis to reconcile these differences:

  • Structural Function vs. Gating Role: Recent cryo-EM structures contradict previous functional models suggesting dynamic roles for KdpC. The data indicate that KdpC remains relatively immobile during the transport cycle, challenging earlier hypotheses about its involvement in gating mechanisms . This contradiction highlights the importance of integrating structural and functional studies rather than relying solely on either approach.

  • Resolving Contradictions: When facing conflicting data regarding KdpC function, consider:

    • Differences in experimental systems (in vitro vs. in vivo studies)

    • Species-specific variations in KdpC function

    • Technical limitations of different methodologies

    • Potential effects of experimental conditions on protein conformation and activity

  • Complementary Approaches: To address contradictions, employ multiple complementary techniques:

    • Combine structural studies (cryo-EM, X-ray crystallography) with functional assays

    • Utilize site-directed mutagenesis to test structure-based hypotheses

    • Develop in vivo reporter systems to monitor KdpFABC activity under physiologically relevant conditions

  • Data Resolution Framework:

Contradiction TypeExampleResolution Approach
Structural vs. FunctionalImmobile KdpC in structures vs. proposed dynamic roleEPR distance measurements during transport cycle
Species-specific differencesVariant phenotypes between bacterial speciesComplementation studies with KdpC from different species
Technical discrepanciesDifferent results from in vitro vs. in vivo studiesDevelopment of more physiologically relevant in vitro systems
Regulatory contextDifferent phenotypes in various genetic backgroundsSystematic analysis in defined genetic backgrounds

By systematically addressing these contradictions, researchers can develop more comprehensive and accurate models of KdpC function within the KdpFABC complex.

What are the most reliable methods for purifying recombinant KdpC for biochemical and structural studies?

Purification of recombinant KdpC for biochemical and structural studies requires special considerations due to its membrane-associated nature:

  • Solubilization Strategy:

    • Test multiple detergents (DDM, LMNG, DMNG) at various concentrations to identify optimal solubilization conditions

    • Consider the use of styrene maleic acid lipid particles (SMALPs) or nanodiscs for maintaining a more native lipid environment

    • Evaluate solubilization efficiency through Western blotting analysis of supernatant vs. pellet fractions

  • Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged KdpC as the initial capture step

    • Size exclusion chromatography (SEC) for further purification and buffer exchange

    • Optional ion exchange chromatography step if higher purity is required

  • Stability Enhancement:

    • Include specific lipids (e.g., phosphatidylglycerol) that may stabilize the protein

    • Maintain critical ions (K+, Mg2+) at appropriate concentrations in all buffers

    • Consider purifying the entire KdpFABC complex rather than KdpC alone for enhanced stability

  • Quality Assessment:

    • SEC-MALS (size exclusion chromatography with multi-angle light scattering) to confirm proper oligomeric state

    • Thermal stability assays to optimize buffer conditions

    • Negative stain electron microscopy to verify proper folding before proceeding to structural studies

  • Recommended Buffer Conditions:

    • 20 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerol, 2 mM DTT, appropriate detergent at 2× CMC

    • For structural studies, consider supplementation with 100-200 mM KCl and 2-5 mM MgCl2

How can researchers effectively analyze the impact of KdpC mutations on Xanthomonas oryzae pv. oryzae virulence?

To effectively analyze the impact of KdpC mutations on X. oryzae pv. oryzae virulence, researchers should implement a comprehensive experimental approach:

  • Mutation Design Strategy:

    • Target conserved residues identified through sequence alignment across bacterial species

    • Design mutations based on structural information to specifically disrupt interactions with other complex components

    • Create alanine-scanning libraries across regions of interest to systematically identify critical residues

  • Phenotypic Characterization:

    • Growth curves under varied potassium concentrations (limiting vs. replete)

    • Motility assays to assess bacterial movement capabilities

    • Type III secretion system (T3SS) activity assays, as T3SS expression has been linked to virulence regulation systems that may interact with potassium homeostasis

  • Virulence Assessment:

    • Rice leaf infection assays with standardized inoculation procedures

    • Quantitative measurement of lesion size and bacterial populations in planta

    • Competitive index assays comparing wild-type and mutant strains in mixed infections

  • Molecular Analysis:

    • Transcriptional profiling of virulence genes in mutant vs. wild-type backgrounds

    • Analysis of HrpG, HrpX, and other T3SS regulators' expression and activity

    • Evaluation of protein-protein interactions to determine if mutations disrupt complex assembly

  • Experimental Design Considerations:

    • Use randomization to eliminate positional effects in greenhouse or growth chamber experiments

    • Implement blocking to control for variables like different batches of plants or environmental variations

    • Include appropriate positive and negative controls (e.g., established virulence mutants, complemented strains)

    • Ensure adequate replication to achieve statistical power

This comprehensive approach allows for robust assessment of how KdpC mutations impact bacterial physiology and virulence while controlling for experimental variables that might confound interpretation.

What techniques can be used to investigate KdpC's role in potassium transport in real-time?

Investigating KdpC's role in potassium transport in real-time requires specialized techniques that can monitor ion movement and protein conformational changes:

  • Potassium-Sensitive Fluorescent Probes:

    • Utilize potassium-sensitive fluorophores (e.g., PBFI, Asante Potassium Green) to monitor K+ flux in real-time

    • Develop bacterial strains expressing genetically encoded potassium sensors for in vivo monitoring

    • Implement ratiometric imaging to correct for variations in probe concentration or cell thickness

  • Electrophysiological Approaches:

    • Solid-supported membrane (SSM)-based electrophysiology to measure transient currents from reconstituted KdpFABC complexes

    • Patch-clamp techniques on giant bacterial spheroplasts for direct measurement of KdpFABC activity

    • Implement voltage protocols to determine voltage dependence of transport activity

  • Real-Time Structural Measurements:

    • Time-resolved EPR spectroscopy with strategically placed spin labels to monitor conformational changes during transport

    • Single-molecule FRET to track distance changes between labeled residues during the transport cycle

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) with quenched-flow apparatus for time-resolved structural dynamics

  • Computational Approaches:

    • Molecular dynamics simulations to model potassium movement through the complex

    • Integration of experimental data with computational models to create a comprehensive understanding of transport mechanisms

  • Experimental Setup for Real-Time Measurements:

    • Rapid perfusion systems to quickly change external potassium concentrations

    • Temperature-controlled chambers to study temperature dependence of transport

    • Synchronized measurements of multiple parameters (K+ concentration, protein conformation, ATP hydrolysis) to correlate different aspects of the transport cycle

These techniques provide complementary data on different aspects of KdpC function and the KdpFABC complex's role in potassium transport, allowing researchers to develop integrated models of transport mechanisms.

How does potassium transport through the KdpFABC complex influence other virulence mechanisms in Xanthomonas oryzae pv. oryzae?

Potassium transport through the KdpFABC complex potentially influences multiple virulence mechanisms in X. oryzae pv. oryzae through both direct and indirect pathways:

  • Type III Secretion System Regulation: Research suggests interconnections between potassium homeostasis and virulence regulation. The PhoPQ two-component system, which influences virulence in X. oryzae pv. oryzae, regulates HrpG, a key controller of type III secretion system expression . Potassium limitation, sensed through the KdpFABC system, may serve as an environmental cue that triggers virulence responses through these regulatory systems.

  • Cellular Energetics: As potassium gradients contribute to membrane potential and cellular energetics, proper functioning of the KdpFABC complex may indirectly support energy-intensive virulence processes such as protein secretion, motility, and production of virulence factors.

  • Osmotic Adaptation During Infection: The KdpFABC complex likely contributes to bacterial adaptation to changing osmotic conditions encountered during plant infection, supporting survival and proliferation in the host environment.

  • Proposed Integration Model:

Virulence SystemPotential Influence of KdpFABC ActivityEvidence/Research Approach
Type III SecretionPotassium homeostasis may signal host environment entry, triggering T3SS expressionMonitor hrp gene expression under controlled K+ conditions
Exopolysaccharide ProductionK+ limitation may alter EPS production affecting biofilm formationCompare EPS production between wildtype and kdpC mutants
MotilityK+ transport may influence flagellar function and sliding motilityAnalyze motility changes in KdpFABC mutants under various K+ conditions
Effector ProductionEnergy availability linked to K+ homeostasis may affect effector synthesisProteomics comparing effector production in various K+ conditions
  • Signaling Pathways: PilZ domain proteins, which function in c-di-GMP signaling pathways affecting virulence and motility , may interact with potassium sensing systems, creating integrated regulatory networks that coordinate multiple aspects of bacterial physiology during infection.

What evolutionary adaptations of the KdpFABC complex can be observed in Xanthomonas oryzae pv. oryzae compared to non-pathogenic bacteria?

The evolutionary adaptations of the KdpFABC complex in X. oryzae pv. oryzae compared to non-pathogenic bacteria likely reflect specialization for the pathogenic lifestyle:

  • Host Environment Adaptation: The KdpFABC complex in X. oryzae pv. oryzae may show adaptations to the specific potassium concentrations encountered in rice apoplastic fluid, which differs from soil environments where many non-pathogenic bacteria reside.

  • Regulatory Integration: Pathogenic bacteria often demonstrate tighter integration of homeostatic systems with virulence regulation. The X. oryzae pv. oryzae KdpFABC complex may have evolved specific interactions with virulence regulatory systems like the PhoPQ two-component system or RaxRH system, which are critical for pathogenicity.

  • Comparative Genomic Analysis Framework:

AspectX. oryzae pv. oryzaeNon-pathogenic RelativesPotential Functional Significance
Gene Organization[Based on genome analysis][Comparative organization]May reflect differences in co-regulation with other genes
Promoter ElementsPotential presence of PIP box or similar regulatory elements Typically absent in non-pathogensCould allow co-regulation with virulence factors
Protein Sequence[Analysis needed][Comparative analysis needed]May show adaptations for specific host environments
Regulatory NetworksIntegration with PhoPQ, RaxRH systems Less complex regulatory integrationAllows coordination of K+ homeostasis with pathogenicity
  • Experimental Approaches to Study Evolution:

    • Complementation studies with KdpC from non-pathogenic bacteria to identify functional differences

    • Analysis of selection pressure on kdpC sequences across Xanthomonas species

    • Experimental evolution under conditions mimicking the host environment to observe adaptation patterns

  • Host-Pathogen Co-evolution: The KdpFABC system may show adaptations reflecting evolutionary pressure from host defense mechanisms that target bacterial ion homeostasis as part of immunity responses.

How can contradictory findings about KdpC structure and function be reconciled through integrated experimental approaches?

Reconciling contradictory findings about KdpC structure and function requires integrated experimental approaches that bridge different methodologies and contexts:

  • Identification of Context-Dependent Effects: Contradictory findings may result from different experimental contexts. For example, cryo-EM structural studies indicate KdpC remains immobile during the transport cycle , contradicting previous hypotheses about dynamic roles. These contradictions can be reconciled by:

    • Comparing protein behavior in different membrane environments

    • Testing function under varying potassium concentrations

    • Examining effects of other cellular components not present in purified systems

  • Combined Methodological Approach:

MethodStrengthLimitationIntegration Strategy
Cryo-EMHigh-resolution structural dataStatic snapshots, potential artifactsCombine with dynamic measurements (EPR, FRET)
Genetic StudiesIn vivo relevanceIndirect functional assessmentConnect phenotypes to specific structural elements
Biochemical AssaysDirect measurement of activityOften uses artificial conditionsDesign conditions matching physiological state
Computational ModelingPredicts dynamic behaviorRequires validationInform models with experimental constraints
  • Resolution of Specific Contradictions:

    • For contradictions regarding KdpC mobility: Implement single-molecule techniques to directly measure conformational changes during transport

    • For contradictions in ion pathway: Combine ion flux measurements with targeted mutations of proposed pathway residues

    • For contradictions in regulatory effects: Develop reporter systems that simultaneously monitor KdpFABC activity and virulence gene expression

  • Framework for Contradiction Resolution:
    a) Clearly define contradictory observations
    b) Identify methodological differences that might explain contradictions
    c) Design experiments that bridge methodological gaps
    d) Develop integrated models that can accommodate seemingly contradictory observations
    e) Test predictions of integrated models with new experiments

This approach acknowledges that apparent contradictions often reflect different aspects of complex biological systems rather than true incompatibilities, and seeks to develop more comprehensive models that incorporate diverse experimental evidence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.