Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xanthomonas oryzae pv. oryzae Probable Ubiquinone Biosynthesis Protein UbiB (ubiB)

Recombinant Xanthomonas oryzae pv. oryzae Probable ubiquinone biosynthesis protein UbiB (ubiB) is a recombinant protein derived from the bacterium Xanthomonas oryzae pv. oryzae, a pathogen responsible for bacterial blight in rice . This protein is involved in the ubiquinone biosynthesis pathway, which is crucial for the electron transport chain and energy production in bacteria. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its use in various biochemical and biotechnological applications.

Characteristics of Recombinant UbiB Protein

The recombinant UbiB protein from Xanthomonas oryzae pv. oryzae is characterized by its specific amino acid sequence and structural features. The protein is produced in a recombinant form, typically in a host organism like Escherichia coli, and is purified for use in research or diagnostic applications.

  • Amino Acid Sequence: The protein sequence includes a specific arrangement of amino acids that define its structure and function. The sequence provided for this protein includes motifs typical of ubiquinone biosynthesis enzymes .

  • Storage and Handling: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability. Repeated freezing and thawing should be avoided .

Biological Role of UbiB in Xanthomonas oryzae pv. oryzae

UbiB is part of the ubiquinone biosynthesis pathway, which is essential for bacterial energy metabolism. Ubiquinone (also known as Coenzyme Q) plays a critical role in the electron transport chain, facilitating the generation of ATP during oxidative phosphorylation.

Research Findings and Applications

Research on recombinant UbiB from Xanthomonas oryzae pv. oryzae is limited, but its study contributes to understanding bacterial metabolism and pathogenicity. The protein can be used in various biochemical assays to study ubiquinone biosynthesis and its role in bacterial physiology.

  • Biochemical Assays: Recombinant UbiB can be used in enzyme assays to study the ubiquinone biosynthesis pathway. This helps in understanding how modifications in this pathway might affect bacterial metabolism and pathogenicity.

  • Diagnostic Tools: The protein could potentially be used in developing diagnostic tools for detecting Xanthomonas oryzae pv. oryzae infections, although this would require further development.

Data and Tables

While specific data tables for recombinant UbiB from Xanthomonas oryzae pv. oryzae are not readily available, the following table summarizes key characteristics of the protein:

CharacteristicDescription
Protein TypeRecombinant protein
SpeciesXanthomonas oryzae pv. oryzae
FunctionUbiquinone biosynthesis
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C
Amino Acid SequenceSpecific sequence defining its structure and function

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; PXO_02769; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain PXO99A)
Target Names
ubiB
Target Protein Sequence
MKAILRASRIGRVILRYRLDALLEGTPAERWLRLAKPFVPRASAEIAVQSRGARLRLALQ ELGPIFVKFGQILSTRRDLIPADVAEELTLLQDRVKPFDGEAARLIVERALGLPVSVAFA SFDTVPLASASIAQVHAATLPPDANGVRREVVVKVLRPEIERQIDADIALLHSLATLVER THPRADKIRPREVVAEIEGTLSAELDLQREGANASVLRRFWEGSDDLYVPEVIWSHTAER ALTLERVYGIPSDDIAKLDAAGIDRKALAAKGVRVFYTQVFRDNFFHADAHAGNIWVDSD PERRLNPRFIALDFGIMGQLSQEDQYYLAENFMAIFHKDYRRMAELHVEAGWMPSNVRID ELEAAARSVCEPYFTRPLSEISLAQVLIKLFRVAQRYELTLQPQLILLQKTLLNIEGVGR QLDPKLDIWAVARPVLERILRERYSPRRVLRELSKRLPEIMTHAPDMPRLVHSWLKQQVE GRHQIDIRSTELLALDLSLRKLQTRVVTAITGSGLLVVAAVLYGLHPDGWYLGTVPVWSW ISGGAGSAALLVAWLRR
Uniprot No.

Target Background

Function
This protein is likely a kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.