Recombinant Xanthomonas oryzae pv. oryzae UPF0060 membrane protein XOO1694 (XOO1694)

What is the structural composition of XOO1694 membrane protein?

XOO1694 is a UPF0060 membrane protein from Xanthomonas oryzae pv. oryzae (strain MAFF 311018) with a full amino acid sequence of 112 residues. The protein sequence is: MNLAPTTLLLFAATALAELVGCYLPYLWLRNGGSVWLLLPTALRLASFVWLLSLHPDASGRVYAAYGGVYIASALGLWLWWVDGVTPTRWDLLGAVCCLFGMAIIMFAPRSA . The protein contains multiple transmembrane domains with hydrophobic regions that facilitate its integration into the bacterial membrane. For structural analysis, researchers should consider computational approaches such as hydropathy plots and transmembrane prediction algorithms before proceeding to experimental structure determination methods.

How should XOO1694 recombinant protein be properly stored and handled in laboratory settings?

The recombinant XOO1694 protein requires specific storage conditions to maintain stability and functionality. Store the protein at -20°C for regular use, and at -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability. Avoid repeated freeze-thaw cycles as these significantly decrease protein activity. Working aliquots can be stored at 4°C for up to one week . When handling the protein, maintain sterile conditions and use low-protein binding tubes to prevent adhesion loss. Researchers should verify protein stability after storage by running activity assays or structural integrity tests before using in critical experiments.

What is the role of Xanthomonas oryzae pv. oryzae in bacterial leaf blight, and how does the XOO1694 protein relate to this pathology?

Xanthomonas oryzae pv. oryzae (Xoo) is the causative agent of bacterial leaf blight (BLB) in rice, which can result in devastating yield losses of up to 70% . The pathogen infiltrates the rice plant through water pores or wounds, colonizes the xylem vessels, and produces exopolysaccharides that block water transport. While the specific function of XOO1694 has not been fully characterized, as a membrane protein it likely plays a role in bacterial membrane integrity, signaling, or transport processes that contribute to Xoo virulence or survival. Research methodologies to investigate its role would include generating knockout mutants (similar to other Xoo protein studies like HrpE ), performing complementation assays, and conducting comparative transcriptomics between wild-type and mutant strains under infection conditions.

What detection methods are used to identify Xoo in environmental and plant samples?

Multiple detection methods have been developed for identifying Xoo in environmental and plant samples:

The cLAMP assay using the LpXoo4009 primer has been shown to effectively detect Xoo at low concentrations in both soil and water samples . For research purposes, the choice of method depends on the required sensitivity, time constraints, and whether quantification is necessary. For field studies or rapid diagnostics, cLAMP offers advantages of speed and sensitivity, while qPCR provides precise quantification for detailed studies of bacterial load .

How can recombinant XOO1694 protein be efficiently expressed and purified for structural and functional studies?

For optimal expression and purification of recombinant XOO1694, researchers should consider:

• Expression system selection: Given that XOO1694 is a membrane protein, expression systems that efficiently handle hydrophobic proteins are recommended. While E. coli systems (particularly C41(DE3) or C43(DE3) strains designed for membrane proteins) are cost-effective, insect cell systems (Sf9 or Hi5) may provide better folding conditions for maintaining native conformation .

• Construct design: The full-length protein (amino acids 1-112) should be cloned with appropriate affinity tags (His6, FLAG, or Strep II) preferably at the C-terminus to minimize interference with membrane integration. Consider including TEV protease cleavage sites for tag removal post-purification.

• Solubilization and purification: Extract the protein using mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol). Purify using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography.

• Quality assessment: Verify structural integrity through circular dichroism spectroscopy, thermal shift assays, and SDS-PAGE analysis. For functional studies, reconstitute the protein in liposomes or nanodiscs to mimic the native membrane environment.

This methodological approach addresses the challenges inherent to membrane protein work while maximizing yield and maintaining protein functionality for downstream applications.

What methodologies can be employed to determine the specific function of XOO1694 in bacterial virulence?

To determine the function of XOO1694 in bacterial virulence, researchers should implement a multi-faceted approach:

• Gene knockout and complementation: Create a ΔXoo1694 mutant strain using homologous recombination or CRISPR-Cas9 technology, similar to methods used for other Xoo proteins . Compare phenotypes with wild-type and perform complementation studies to confirm specificity of observed effects.

• Phenotypic characterization: Assess changes in bacterial growth, biofilm formation, motility, stress tolerance, and virulence in the mutant strain. Specifically examine:

  • Growth curves in various media conditions

  • Swimming, swarming, and twitching motility assays

  • Biofilm quantification using crystal violet staining

  • Stress tolerance (pH, temperature, oxidative stress)

  • Plant infection assays using susceptible rice varieties

• Transcriptomic and proteomic analyses: Compare gene expression profiles between wild-type and mutant strains using RNA-seq, and protein expression using LC-MS/MS to identify affected pathways.

• Protein interaction studies: Identify protein interaction partners using techniques such as bacterial two-hybrid screens, co-immunoprecipitation, or proximity labeling approaches.

• Localization studies: Determine subcellular localization using fluorescent protein fusions or immunogold electron microscopy to visualize distribution within the bacterial cell.

By integrating these methodological approaches, researchers can build a comprehensive understanding of XOO1694's role in virulence mechanisms and potentially identify new targets for disease control strategies.

How does the colonization and persistence of Xoo in the environment impact disease management strategies, and what methodologies can quantify this impact?

Xoo demonstrates remarkable environmental persistence, with bacteria detected in soil for up to 12 weeks and in water for up to 6 weeks . Additionally, common grasses found in rice fields, such as Eriochloa procera, Echinochloa crus-galli, and Chloris barbata serve as temporary reservoirs , creating a complex ecological cycle that complicates disease management.

To quantify environmental persistence and develop effective management strategies, researchers should employ:

• Environmental sampling and qPCR quantification: Systematic soil, water, and alternative host sampling followed by qPCR analysis using primers targeting Xoo-specific sequences. Results can be presented as bacterial genome copies per gram or milliliter.

• Survival dynamics modeling: Generate mathematical models incorporating environmental factors (temperature, pH, soil type) that influence bacterial survival rates. This requires time-course sampling under controlled environmental conditions.

• Transmission experiments: Design experiments that track pathogen movement from infected plants to soil, water, and neighboring plants using fluorescently labeled bacteria or unique genetic markers.

• Management strategy evaluation: Compare efficacy of various control measures (crop rotation, field flooding, biological control agents) by measuring:

  • Reduction in environmental Xoo load (qPCR quantification)

  • Decreased disease incidence in subsequent plantings

  • Economic impact assessment

This comprehensive approach yields quantitative data on environmental persistence that can inform integrated disease management strategies tailored to specific agroecological contexts.

How can comparative genomic analysis of Xoo strains inform our understanding of XOO1694 function and evolution?

Comparative genomic analysis provides crucial insights into XOO1694 function and evolution through several methodological approaches:

• Phylogenetic analysis: Construct phylogenetic trees based on XOO1694 sequences from different Xoo strains and related Xanthomonas species to trace evolutionary history and selective pressures. Calculate Ka/Ks ratios to determine if the gene is under purifying, neutral, or positive selection.

• Synteny analysis: Examine the genomic context of XOO1694 across strains to identify conserved gene neighborhoods that might suggest functional associations. This approach has been successfully applied in comparative studies of Xoo strains from different geographical regions .

• Structural variation identification: Analyze structural variations (insertions, deletions, rearrangements) in and around the XOO1694 gene that might impact its expression or function. Methods include:

  • Whole genome alignment using tools like MAUVE or MUMmer

  • Read mapping against a reference genome

  • Long-read sequencing for complex structural variant detection

• Transcriptomic correlation: Integrate comparative genomics with transcriptomic data from different strains to identify co-expression patterns that might reveal functional networks involving XOO1694.

• Domain architecture analysis: Compare protein domain architecture of XOO1694 across strains and species to identify conserved motifs critical for function versus variable regions that might confer strain-specific adaptations.

These approaches collectively provide a comprehensive evolutionary context for XOO1694, potentially revealing functional aspects that cannot be determined through experimental approaches alone.

What are the optimal conditions for expressing recombinant XOO1694 in heterologous systems?

The optimal conditions for heterologous expression of recombinant XOO1694 vary depending on the expression system chosen. Based on research with similar membrane proteins, the following conditions are recommended:

For E. coli expression systems, inclusion of 5% glycerol in the growth medium helps stabilize membrane proteins. Additionally, pre-induction growth temperature should be maintained at 37°C until an OD600 of 0.6-0.8 is reached. The transition to lower temperatures at induction is critical for proper folding of membrane proteins like XOO1694.

For detergent screening during extraction and purification, researchers should test a panel including DDM (0.5-1%), LMNG (0.01-0.05%), and Cymal-6 (0.5%) to determine optimal solubilization conditions. This methodological approach maximizes the chances of obtaining functional XOO1694 for downstream structural and functional analyses.

How should researchers design experiments to study XOO1694's role in bacterial membrane function and pathogenicity?

A comprehensive experimental design to study XOO1694's role should incorporate the following methodological approaches:

• Creation of genetic tools:

  • Generate a clean deletion mutant (ΔXoo1694) using two-step homologous recombination

  • Create complementation strains with native promoter

  • Develop inducible expression systems for controlled studies

  • Engineer strains with tagged versions (His, FLAG, GFP) for localization and interaction studies

• Membrane function assays:

  • Membrane integrity: Measure propidium iodide uptake in wild-type vs. mutant strains

  • Membrane potential: Use DiBAC4(3) fluorescent probe to assess changes

  • Lipid composition: Perform lipidomic analysis on isolated membranes

  • Membrane protein organization: Use FRET-based approaches with labeled proteins

• Infection model experiments:

  • Rice leaf clip inoculation using the methodology described in :

    • Prepare bacterial suspensions at 10^8 CFU/mL

    • Inoculate 45-day-old seedlings using clip method

    • Assess lesion length 14 days post-inoculation

    • Compare disease severity between wild-type and ΔXoo1694 strains

• Signaling pathway analysis:

  • Phosphoproteome analysis of wild-type vs. mutant strains

  • Calcium flux measurements during infection process

  • cAMP/cGMP quantification to assess potential role in second messenger signaling

• Environmental stress response:

  • Survival assays under various stressors (pH, temperature, oxidative)

  • Competitive fitness assays in mixed populations

  • Biofilm formation capacity in environmental mimicking conditions

This systematic approach allows researchers to comprehensively characterize XOO1694's role from molecular mechanisms to pathogenicity outcomes.

What mixed-methods research approaches can be applied to understand the ecological role of Xoo in rice ecosystems?

Mixed-methods approaches combining quantitative and qualitative methodologies are particularly valuable for understanding complex ecological interactions involving Xoo in rice ecosystems. Based on established mixed-methods frameworks , researchers should consider:

• Sequential exploratory design:

  • Begin with qualitative field observations of disease patterns

  • Develop quantitative sampling strategies based on observed patterns

  • Conduct systematic environmental sampling (soil, water, alternative hosts)

  • Analyze using molecular quantification methods (qPCR, cLAMP)

  • Return to qualitative assessment to interpret quantitative findings

• Concurrent triangulation approach:

  • Simultaneously collect field-level ecological data and laboratory experimental data

  • Field component: Measure environmental parameters (pH, temperature, nutrient levels) alongside Xoo prevalence

  • Laboratory component: Test hypotheses about environmental factor effects on Xoo survival

  • Integrate findings to develop comprehensive ecological models

• Community-based participatory research elements:

  • Incorporate farmer knowledge of disease patterns and management practices

  • Design experimental interventions based on combined scientific and practical knowledge

  • Evaluate outcomes using both scientific metrics and farmer assessments

• Multi-scale temporal analysis:

  • Short-term: Hourly/daily tracking of pathogen movement during infection events

  • Medium-term: Seasonal population dynamics in relation to crop cycles

  • Long-term: Year-to-year persistence and evolution in agricultural landscapes

This integrative approach acknowledges the complexity of agroecosystems and provides a more comprehensive understanding of Xoo ecology than either quantitative or qualitative methods alone could achieve .

How can phage therapy research methodologies be applied to control Xoo infections in rice cultivation?

Research into bacteriophage therapy for Xoo control requires specific methodologies to ensure efficacy and safety:

• Phage isolation and characterization protocol:

  • Sample collection from rice fields (water, soil, and field debris)

  • Enrichment culture using Xoo as host bacteria

  • Plaque assay for phage isolation and purification

  • Host range determination against diverse Xoo strains

  • Morphological characterization via transmission electron microscopy

  • Genomic sequencing and annotation to confirm absence of virulence or toxin genes

• Phage stability assessment:

  • Temperature stability tests (4°C–40°C)

  • pH stability evaluation (pH 5–9)

  • UV and sunlight exposure tests

  • Chemical compatibility testing with commonly used agricultural compounds

• Efficacy testing methodology:

  • Laboratory assays:

    • One-step growth curve analysis to determine latent period and burst size

    • Biofilm degradation assays

  • Greenhouse trials:

    • Randomized complete block design

    • Application timing optimization (preventive vs. curative)

    • Delivery method comparison (spray vs. irrigation)

    • Formulation testing (with additives like skim milk to improve stability)

• Field trial design:

  • Plot size: Minimum 5m × 5m with buffer zones

  • Treatments: Phage preparations at different concentrations (10^6-10^8 PFU/mL)

  • Controls: Untreated infected, chemical standard, and uninfected controls

  • Application schedule: Evaluate single vs. multiple applications

  • Assessment parameters:

    • Disease incidence and severity scoring

    • Yield components measurement

    • Phage persistence monitoring in phyllosphere and soil

This comprehensive methodological approach addresses the key challenges in developing effective phage-based biocontrol strategies for Xoo in rice cultivation systems.

How should researchers address data inconsistencies when studying XOO1694 expression under various environmental conditions?

When faced with data inconsistencies in XOO1694 expression studies, researchers should implement the following methodological approach:

What bioinformatic approaches are most appropriate for analyzing the evolutionary history of XOO1694 across Xanthomonas species?

To rigorously analyze the evolutionary history of XOO1694 across Xanthomonas species, researchers should employ a multi-layered bioinformatic approach:

• Sequence acquisition and verification:

  • Retrieve XOO1694 homologs using both reciprocal BLAST and profile-based searches (HMM)

  • Verify annotation accuracy through domain architecture analysis

  • Include outgroups from related bacterial genera for rooting phylogenies

  • Check for potential horizontal gene transfer events using genomic context analysis

• Multiple sequence alignment optimization:

  • Generate initial alignments using MAFFT or MUSCLE algorithms

  • Refine alignments with HMMER-based approaches for transmembrane regions

  • Apply automated tools like TrimAl followed by manual curation of alignment quality

  • Test multiple alignment parameters and select optimal settings based on alignment quality metrics

• Phylogenetic model selection and tree construction:

  • Perform model testing using ModelFinder or ProtTest

  • Implement multiple tree-building methods:

    • Maximum Likelihood (RAxML or IQ-TREE)

    • Bayesian Inference (MrBayes or BEAST)

    • Maximum Parsimony as a complementary approach

  • Assess node support using ultrafast bootstrap approximation (UFBoot) and SH-aLRT tests

  • Compare topology across methods to identify consistently recovered relationships

• Selection analysis:

  • Calculate site-specific selection pressures using PAML or MEME

  • Identify functionally important residues under purifying selection

  • Detect potential adaptive evolution using branch-site models

  • Correlate selection patterns with structural features and functional domains

• Reconciliation with species evolution:

  • Compare XOO1694 phylogeny with established Xanthomonas species phylogeny

  • Identify potential gene duplication, loss, or lateral transfer events

  • Reconstruct ancestral sequences at key nodes using empirical Bayes methods

This comprehensive bioinformatic workflow allows researchers to trace XOO1694's evolutionary trajectory with high confidence, revealing patterns of conservation and innovation across Xanthomonas species.

What emerging technologies show the most promise for elucidating XOO1694 function in bacterial pathogenesis?

Several cutting-edge technologies show exceptional promise for advancing our understanding of XOO1694's role in pathogenesis:

Researchers combining these technologies will be positioned to make transformative discoveries about XOO1694's structural dynamics, interaction partners, and context-dependent functions during infection processes.

How might research on XOO1694 contribute to new approaches for bacterial leaf blight management in rice?

Research on XOO1694 could lead to innovative bacterial leaf blight management strategies through several promising research pathways:

• Structure-based inhibitor design:

  • Determination of high-resolution XOO1694 structure using cryo-EM or X-ray crystallography

  • Computational screening of chemical libraries to identify binding pocket ligands

  • Structure-activity relationship studies to optimize lead compounds

  • Development of peptidomimetics that interfere with XOO1694-partner interactions

  This approach could yield specific inhibitors that disrupt membrane function without affecting beneficial microorganisms.

• Immunomodulatory approaches:

  • If XOO1694 acts as a PAMP (Pathogen-Associated Molecular Pattern) recognized by rice immune receptors:

    • Identify the specific epitopes that trigger immunity

    • Develop stable recombinant derivatives for foliar application

    • Engineer priming treatments that enhance natural resistance

• Resistant variety development:

  • Screen germplasm collections for enhanced recognition of XOO1694

  • Identify genetic loci conferring resistance through GWAS studies

  • Engineer enhanced recognition using modern breeding techniques

  • Develop gene-edited rice varieties with altered susceptibility targets

• Ecological management strategies:

  • Identify environmental conditions that downregulate XOO1694 expression

  • Develop field management practices that minimize bacterial persistence

  • Design crop rotation strategies based on alternative host compatibility

  • Select rice-associated microbiome members that competitively suppress Xoo

• RNA interference technology:

  • Design stable dsRNA molecules targeting XOO1694 mRNA

  • Develop application methods that enhance uptake by bacteria

  • Engineer rice varieties expressing inhibitory RNA structures

  • Combine with carrier systems for enhanced delivery and stability

These research directions could converge to create integrated management systems that specifically target XOO1694-dependent processes while minimizing environmental impact and resistance development.

What methodological advances are needed to better understand membrane protein dynamics in bacterial pathogens like Xoo?

Advancing our understanding of membrane protein dynamics in bacterial pathogens like Xoo requires methodological innovations in several key areas:

• In situ structural biology techniques:

  • Development of correlative light and electron microscopy approaches optimized for bacterial cells

  • Refinement of live-cell super-resolution microscopy to capture membrane protein clustering during infection

  • Adaptation of single-molecule tracking methods for use in infection models

  • Integration of time-resolved structural methods (TR-XFEL, TR-EM) with functional assays

• Membrane mimetic systems:

  • Engineering of biomimetic membrane systems that better replicate the complex lipid composition of Xoo membranes

  • Development of asymmetric supported bilayers that model the inner/outer membrane differences

  • Creation of microfluidic platforms that allow controlled manipulation of membrane tension and curvature

  • Design of membrane-protein nanodiscs with controlled lipid composition for structural studies

• Biosensor development:

  • Creation of genetically-encoded sensors for membrane properties (fluidity, potential, thickness)

  • Development of split-GFP systems optimized for membrane protein interaction studies

  • Engineering of FRET-based tension and conformation sensors for membrane proteins

  • Design of activity-based probes for specific membrane protein functions

• Computational method enhancements:

  • Integration of atomistic and coarse-grained simulation approaches for multi-scale modeling

  • Development of machine learning approaches to predict membrane protein-lipid interactions

  • Refinement of force fields specifically optimized for bacterial membrane environments

  • Creation of more accurate transmembrane topology prediction algorithms

• Scalable functional assays:

  • Establishment of high-throughput screening methods for membrane protein function

  • Development of label-free detection systems for membrane transport processes

  • Creation of microfluidic devices for single-cell analysis of membrane dynamics

  • Engineering of synthetic cell systems for isolated component analysis

These methodological advances would collectively transform our ability to study membrane proteins like XOO1694 in their native context, bridging the gap between static structural information and dynamic functional understanding.