Recombinant Xanthomonas phage phiLf Attachment protein G3P (III)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Xanthomonas phage phiLf (Bacteriophage phi-Lf)
Target Names
III
Target Protein Sequence
MSPSLFLGWGDDYFVVLWIHGRAVRLGRRQGVGRVIRVSLAMLILLALTFSPIVHATCVQ TEPSTSANNGSWACSDQGEAFAKASSMGVPADLSVCRMKSIRAVSSGPGVFSQRMTYPGD TCGIGYDLDIGTGNATYPDTATCAKRPSQSGWTNPTAPTPSDVCNDGCYYTYAVDAGGPK GYTYVPSGATCTTDDAAPPIDDGGDGDDDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGG DGGGDGGGDGDGGGDGDGDGDGDGDGEEGGEGAPMSELYKKSGKTVESVLSKFNTQVRGT PMVAGIGDFMKVPSGGSCPVFSLGASKWWDAMTINFHCGGDFLAFLRAAGWVILAIAAYA AIRIAVT
Uniprot No.

Target Background

Function

Recombinant Xanthomonas phage phiLf Attachment protein G3P (III) plays crucial roles in both viral genome penetration into the bacterial host via pilus retraction and in the extrusion process. Initially, G3P mediates phage adsorption to its primary receptor, the F-pilus tip. Subsequent interaction with the host entry receptor TolA triggers viral DNA penetration into the host cytoplasm. During extrusion, G3P's C-terminal domain facilitates the release of the membrane-anchored virion from the cell.

Protein Families
Inovirus G3P protein family
Subcellular Location
Virion. Host membrane; Single-pass membrane protein. Note=Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Q&A

What is the G3P(III) attachment protein and what is its biological significance?

G3P(III) (Gene 3 Protein) is an essential attachment protein found in Xanthomonas phage phiLf that plays a crucial role in phage propagation through mediating host recognition and infection. The protein consists of three distinct functional domains that work together during the bacterial infection process . G3P represents a critical component in the phage lifecycle, as it enables the initial contact between the phage and its bacterial host, making it fundamental to understanding phage-host interactions and potential applications in biotechnology.

What is the domain architecture of G3P and how do these domains function?

G3P consists of three well-defined domains with distinct functions in the infection process :

  • N1 domain: Interacts with the bacterial TolA receptor, continuing the infection process after initial attachment

  • N2 domain: Binds to the F pilus of the bacterial host, initiating the infection process

  • CT domain (C-terminal domain): Anchors G3P in the phage coat, integrating the protein into the viral particle structure

These domains must remain tightly linked for the phage to maintain infectivity, as they function in a coordinated sequence during the multi-step infection process. The domain organization enables a sequential binding mechanism that facilitates successful host cell penetration and subsequent phage replication .

What expression systems are optimal for producing functional recombinant G3P(III)?

While the optimal expression system for Xanthomonas phage phiLf G3P(III) specifically isn't detailed in the search results, several general approaches are applicable based on similar recombinant phage protein production:

  • Expression host selection: E. coli-based systems are commonly used for phage protein expression, with strains optimized for proper folding of complex proteins

  • Vector design considerations:

    • Codon optimization for the expression host

    • Inclusion of appropriate secretion signals if needed

    • Selection of fusion tags that enhance solubility and facilitate purification

For optimal storage of the purified protein, a Tris-based buffer with 50% glycerol is recommended, with storage at -20°C for regular use or -80°C for extended periods. Importantly, researchers should avoid repeated freeze-thaw cycles, as noted in the handling recommendations .

How can the thermal stability of G3P variants be experimentally assessed?

Based on established research protocols, thermal stability of G3P variants can be assessed through several complementary approaches :

MethodMeasurementAdvantagesApplications
Proteolytic susceptibilityTemperature at which G3P becomes protease-accessibleFunctional readout of domain integrityProside selection method
Thermal denaturationUnfolding transition temperatures (Tm)Reveals biphasic unfolding behaviorDomain stability comparison
Functional infectivityTemperature-dependent phage infectionDirect biological relevanceCorrelating stability with function
Circular dichroismSecondary structure changesMonitors structural transitionsDetailed folding analysis

In previous studies, wild-type G3P became protease-accessible at approximately 40°C, while engineered variants remained resistant at temperatures approaching 60°C, demonstrating significant improvements in thermal stability through directed evolution approaches .

What biophysical techniques are most effective for characterizing G3P domain interactions?

Multiple biophysical techniques can effectively characterize the complex domain interactions within G3P :

  • Thermal and chemical denaturation studies: These reveal the biphasic nature of G3P unfolding, distinguishing between:

    • First transition: Domain dissociation and N2 unfolding (occurring concertedly)

    • Second transition: Independent unfolding of the more stable N1 domain

  • Proteolytic susceptibility assays: Provide functional readouts of structural integrity and domain interactions

  • Fragment analysis: Purification and characterization of domain fragments (e.g., N1-N2) allows isolated study of specific domain interactions

  • Mutagenesis studies: Systematic mutation of residues at domain interfaces, followed by stability analysis, identifies key interaction points

  • Structural techniques: X-ray crystallography, NMR spectroscopy, or cryo-EM would provide direct visualization of domain architectures and interfaces

How has G3P been utilized in protein engineering applications?

G3P has been ingeniously utilized in protein engineering through a method called Proside (Protein Stability Increased by Directed Evolution) . This technique exploits the requirement that G3P domains must remain tightly linked for phage infectivity:

  • Method principle: A library of protein variants is inserted between the N2 and CT domains of G3P

  • Selection process:

    • The phage library is subjected to proteolytic treatment

    • Only variants stable enough to resist proteolysis maintain the essential linkage between G3P domains

    • These stable variants preserve phage infectivity and can be selected

  • Applications:

    • Identification of stabilizing mutations in target proteins

    • Study of protein folding and stability principles

    • Development of proteins with enhanced thermal resistance

The effectiveness of this method is limited by G3P's own proteolytic stability, which researchers have improved through directed evolution, creating variants with substantially enhanced thermal stability (resistance to proteolysis at temperatures approaching 60°C compared to 40°C for wild-type) .

What molecular mechanisms govern the stability differences between G3P domains?

Research into G3P domain stability has revealed sophisticated molecular mechanisms that contribute to differential domain stability :

These principles demonstrate how evolution has fine-tuned the stability of multi-domain proteins through domain interfaces rather than simply maximizing the stability of each domain independently .

How do mutations in G3P affect phage infectivity and host range?

Mutations in G3P can significantly impact phage infectivity through several mechanisms :

  • Domain stability effects: Mutations altering individual domain stability directly impact proper folding and function of the binding domains

  • Interdomain interaction effects: Mutations at domain interfaces, particularly in the hinge subdomain of N2, can strengthen or weaken essential interdomain interactions

  • Temperature-dependent infectivity: Enhanced thermal stability correlates with maintained infectivity under challenging environmental conditions

  • Host recognition alterations: Mutations in binding interfaces may modify host specificity, potentially changing:

    • Receptor recognition specificity

    • Binding affinity for host cell structures

    • Host range breadth

In comparative studies, Xanthomonas phages show interesting differences in host range determinants. For instance, phage phiL7 lacks the tail fiber protein gene with domain duplications thought to be important for host range determination in other phages, suggesting alternative mechanisms for host specificity .

What specific mutations have proven most effective in enhancing G3P stability?

Directed evolution experiments have identified key mutations that significantly enhance G3P stability :

  • Location pattern: The most effective stabilizing mutations were located in domain N2, particularly within its hinge subdomain

  • Mechanistic basis: These mutations enhance stability by strengthening the critical interactions between N1 and N2 domains

  • Stability improvement: Selected variants with 1-4 mutations showed progressive increases in thermal stability:

    • Wild-type G3P: Protease-accessible at ~40°C

    • Engineered variants: Resistant to proteolysis at temperatures approaching 60°C

  • Selection strategy: These improvements were achieved through iterative rounds of random in vivo mutagenesis followed by proteolytic selection

This research demonstrates the principle that targeted mutations at domain interfaces can dramatically improve multi-domain protein stability, with potential applications beyond G3P to other complex protein systems .

How does the unfolding pathway of G3P inform our understanding of multi-domain protein stability?

The unfolding studies of G3P have provided valuable insights into multi-domain protein stability principles :

  • Biphasic unfolding behavior: G3P exhibits two distinct thermal transitions:

    • First transition: Domain dissociation and N2 unfolding occur concertedly

    • Second transition: Independent unfolding of the more stable N1 domain

  • Stability hierarchy: The differential stability of domains (N1 > N2) creates a sequential unfolding pathway

  • Interface importance: Domain interfaces, rather than domain cores, often represent the weakest links in multi-domain protein stability

  • Cooperativity principles: The concerted unfolding of domain interfaces and less stable domains demonstrates how protein regions can be thermodynamically coupled

What are the most promising applications of G3P research in biotechnology?

G3P research opens several promising avenues for biotechnology applications:

  • Protein engineering platform: The Proside method using G3P provides a powerful platform for directed evolution of proteins with enhanced stability, with potential applications in:

    • Industrial enzyme development

    • Therapeutic protein engineering

    • Biosensor development

  • Phage-based antimicrobials: Understanding G3P structure and function could inform the development of engineered phages with tailored host specificity for targeted antimicrobial applications against Xanthomonas plant pathogens

  • Structure-guided protein design: Principles derived from G3P domain interactions could guide the rational design of multi-domain proteins with optimized stability and function

  • Diagnostic applications: Engineered G3P variants could potentially serve as recognition elements in biosensors for bacterial detection

  • Fundamental protein science: G3P continues to serve as an excellent model system for understanding principles of protein folding, stability, and evolution .

What challenges remain in optimizing G3P expression and purification for research applications?

Several challenges persist in optimizing G3P expression and purification for research applications:

  • Domain stability differences: The differential stability between N1 and N2 domains presents challenges during expression and purification, potentially leading to partial unfolding or degradation

  • Proteolytic sensitivity: G3P's inherent susceptibility to proteolysis necessitates careful handling and potentially the use of protease inhibitors during purification

  • Proper folding: Ensuring correct folding of all three domains and their proper interaction during recombinant expression requires optimization of expression conditions

  • Storage stability: The recommendation to avoid freeze-thaw cycles suggests potential stability issues during storage and handling

  • Scale-up considerations: While laboratory-scale production may be straightforward, scaling up for larger research applications might encounter challenges in maintaining consistent folding and stability

Addressing these challenges will require systematic optimization of expression systems, purification protocols, and stabilization strategies to provide researchers with high-quality G3P for diverse research applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.