Recombinant Xanthomonas phage phiLf Gene 1 protein (I)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
I; Gene 1 protein; G1P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Xanthomonas phage phiLf (Bacteriophage phi-Lf)
Target Names
I
Target Protein Sequence
MLVFNEGVPRAGKSYDAVKNHILPALKKGRRVFARLNGLRFDRIAKHLGMAENDVQHLLV LVDTKDVSKLFACTQDESGKWCIPDEFKDALVVIDEVHEFYVNERKPLAPAVENFWALLG QNGGDAVIMTQWINRLHSAVKARIEKKNTFQKLTAIGMKGRYRVTYFHTTSPGKFEKVGG QTLKYDPAIFPLYDGYAPGAENTEVYEEGGKNVWAAMAVRAAIFLTLGGVGIYFFMHYFT KDRADPNKPMASASQTTKPTHVGAGFANGAPSVPIQPPPPDPLADLTQEQRYVAQLADKG RIRLSARARVGDQDRAWIQWIDASNNVVEELDLSQLRALGYSVSVVTYGVRLSAGKHIMV ATAWPWTAPIREKDARLYNMAPDGSGGAAGVATAGSDGGGADRDQVRGGVIEYGPRTQGT FPDNKGYSSSTSTPATTLQM
Uniprot No.

Target Background

Function

Isoform G1P plays a crucial role in phage assembly, increasing the number of adhesion zones between the inner and outer membranes of the host cell. Phage extrusion occurs at these sites. It may collaborate with G4P in forming the pathway for phage assembly and extrusion. Isoform G11P is also involved in phage assembly, likely contributing structurally to the formation of the phage assembly site.

Protein Families
Inovirus G1P protein family
Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the functional role of Gene 1 protein in phiLf phage biology?

Gene 1 protein functions primarily in phage DNA replication and is believed to be involved in the packaging signal (PS) recognition system. It likely acts similarly to the replication proteins found in other Xanthomonas phages, where it participates in the initiation of DNA replication by recognizing specific sequences within the origin of replication. In phiLf-UK (a close relative to phiLf), this protein interacts with a 4 stem-loop structure containing a conserved 5'-CTTG-3' recognition sequence and putative nicking site G304 located in SL2 .

What are the optimal storage conditions for recombinant phiLf Gene 1 protein?

For optimal stability and activity, the recombinant Xanthomonas phage phiLf Gene 1 protein should be stored as follows:

  • Short-term storage (up to 1 week): 4°C in working aliquots

  • Standard storage: -20°C in Tris-based buffer with 50% glycerol

  • Long-term storage: -80°C in Tris-based buffer with 50% glycerol

Repeated freeze-thaw cycles should be avoided as they significantly reduce protein activity. It is recommended to prepare small working aliquots for routine experiments .

How can I validate the activity of recombinant phiLf Gene 1 protein in vitro?

To validate protein activity, researchers should employ a multi-faceted approach:

  • DNA binding assay: Using electrophoretic mobility shift assay (EMSA) to detect binding to the phage packaging signal (PS) region, particularly the stem-loop structures in the origin of replication.

  • Replication initiation assay: Monitoring the ability to nick DNA at specific sites (e.g., G304 in phiLf-UK) and initiate rolling-circle replication.

  • ATPase activity: Measuring ATP hydrolysis, as the protein contains characteristic ATPase motifs (GVPRAGKS) typical of replication proteins.

  • Circular dichroism (CD) spectroscopy: Assessing proper protein folding and structural integrity.

Positive controls should include known active replication proteins from related phages such as Xanthomonas phage XacF1 .

How can phiLf Gene 1 protein be used to study phage-host interactions?

The Gene 1 protein serves as an excellent tool for investigating phage-host interactions through multiple experimental approaches:

  • DNA-protein interaction studies: Using purified Gene 1 protein to identify binding sites on host genomic DNA, particularly at the host dif site (attB) where integration occurs.

  • Protein-protein interaction assays: Employing co-immunoprecipitation or yeast two-hybrid systems to identify host proteins that interact with Gene 1 protein, such as host replication machinery components.

  • Functional genomics: Creating recombinant Gene 1 protein variants with specific mutations to assess their impact on phage replication and host physiology.

  • Localization studies: Using fluorescently tagged Gene 1 protein to track its subcellular localization during infection .

These approaches provide insights into the molecular mechanisms of phage replication and integration into the host genome.

What potential applications exist for phiLf Gene 1 protein in controlling plant pathogens?

Research suggests several promising applications:

ApplicationMechanismPotential Efficacy
Biocontrol agentUsing intact phage to infect and reduce virulence of Xanthomonas pathogensDemonstrated reduction in virulence factors and citrus canker disease symptoms
Engineered resistanceUsing Gene 1 protein to interfere with replication of other harmful phagesTheoretical application, requires further validation
Diagnostic toolUsing antibodies against Gene 1 protein to detect phage-infected bacterial populationsPotentially high specificity for monitoring infection status

Studies have shown that infection by filamentous phages like XacF1 (related to phiLf) causes several physiological changes in bacterial host cells, including reduced extracellular polysaccharide production, lower motility, slower growth rate, and dramatically reduced virulence, making them promising biocontrol agents against diseases like citrus canker .

How does the packaging signal (PS) interact with phiLf Gene 1 protein during phage assembly?

The interaction between packaging signal (PS) and Gene 1 protein represents a sophisticated molecular mechanism:

Recent research has identified that Xanthomonas phage PS consists of a DNA hairpin with the consensus sequence GGX(A/-)CCG(C/T)G in the stem and conserved C/T nucleotides in the loop. These structural elements are essential for PS activity. Unlike the Ff phages, the 5' to 3' orientation of PS sequence is not critical for competence in Xanthomonas phages .

The PS-binding protein PSB15 (PS Binding 15kDa) directly binds to the PS and targets phage DNA to the inner membrane. This interaction is later released by thioredoxin (Trx), a host protein, establishing a phage assembly checkpoint controlled by PS/PSB15/Trx .

This molecular relationship reveals the diversity of PS in filamentous phages and demonstrates multiple assembly mechanisms these phages employ for reproduction.

How do the structural properties of phiLf Gene 1 protein compare to similar proteins in other Xanthomonas phages?

Comparative analysis reveals both conserved and divergent features:

PhageProteinSize (aa)Shared Identity with phiLf Gene 1Key Structural Differences
phiLfGene 1 (I)440100%Reference protein
XacF1pII homolog~420~60-70%Extended C-terminal domain
phiL7p15VariableLimited homologyDifferent domain organization
ϕLf-UKGene 1~440~98%Nearly identical structure
ϕLf2Gene 1~440~86%Minor variations in C-terminus

What are the common pitfalls in working with recombinant phiLf Gene 1 protein and how can they be addressed?

Researchers frequently encounter several challenges when working with this protein:

  • Protein aggregation: Gene 1 protein can form aggregates during purification or storage.

    • Solution: Add 5-10% glycerol and 0.1% non-ionic detergent to the buffer system; maintain temperature below 25°C during purification.

  • Loss of activity: Activity degradation can occur even when following proper storage protocols.

    • Solution: Add reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues; validate activity before critical experiments.

  • Non-specific binding: In interaction studies, Gene 1 protein may exhibit non-specific DNA binding.

    • Solution: Include competitor DNA (poly dI-dC) in binding reactions; optimize salt concentration in binding buffers (typically 50-150 mM NaCl).

  • Expression difficulties: Low soluble protein yield in recombinant systems.

    • Solution: Express as fusion protein with solubility tags (MBP, SUMO); optimize induction conditions (lower temperature, reduced IPTG concentration) .

How can advanced structural biology techniques be applied to study phiLf Gene 1 protein?

Advanced structural analysis provides crucial insights:

  • Cryo-electron microscopy: Can reveal the 3D structure of Gene 1 protein in complex with DNA, particularly its interaction with the packaging signal. This technique has successfully elucidated structures of similar phage replication proteins.

  • X-ray crystallography: While challenging due to the flexible nature of replication proteins, crystallization of the nucleotide-binding domain can reveal ATP hydrolysis mechanisms.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Useful for mapping protein-DNA interaction sites and conformational changes upon binding.

  • Single-molecule techniques: FRET or optical tweezers can be used to study real-time dynamics of DNA binding and nicking activities of Gene 1 protein during replication initiation .

How does the integration of phiLf phage DNA into the bacterial genome influence gene expression and bacterial virulence?

Integration of phiLf phage DNA into the Xanthomonas genome occurs at the host dif site (attB) and is mediated by the host XerC/D recombination system. This integration has profound effects on bacterial physiology:

  • Virulence reduction: Phage integration leads to dramatically reduced virulence, potentially by disrupting key virulence gene expression or altering membrane properties.

  • Metabolic changes: Infected bacteria show lower levels of extracellular polysaccharide production, reduced motility, and slower growth rate.

  • Transcriptional reprogramming: RNA-seq analysis of infected versus uninfected bacteria reveals differential expression of hundreds of genes, particularly those involved in pathogenicity.

  • CRISPR interactions: Some Xanthomonas strains possess CRISPR systems that may interact with the phage genome, affecting integration efficacy and stability .

These changes make phiLf and related phages promising candidates for biocontrol strategies against plant pathogens like those causing citrus canker disease.

What role might phiLf Gene 1 protein play in the development of new molecular biology tools?

Emerging research suggests several innovative applications:

  • DNA replication tool: The protein's ability to initiate rolling-circle replication at specific sites makes it potentially useful for specialized DNA amplification methods.

  • Genome editing applications: The site-specific DNA binding and potential nicking activities could be harnessed for targeted genome modification, similar to how other phage proteins have been adapted.

  • Phage display platform: The understanding of phage assembly mechanisms involving Gene 1 protein could lead to improved phage display technologies for peptide and protein engineering.

  • Synthetic biology components: The packaging signal and its interaction with Gene 1 protein represent a programmable biological switch that could be incorporated into synthetic genetic circuits .

The ongoing characterization of this protein's structure-function relationships will likely reveal additional applications in molecular biology and biotechnology.

What are the key unanswered questions regarding phiLf Gene 1 protein that warrant further investigation?

Several critical knowledge gaps remain to be addressed:

  • Structural determinants of specificity: While we know the protein interacts with specific DNA sequences, the exact structural elements conferring this specificity remain undefined.

  • Host factor interactions: The complete set of host proteins that interact with Gene 1 protein during phage replication and integration is unknown.

  • Regulatory mechanisms: How Gene 1 protein expression is regulated during the phage life cycle and how this regulation affects the switch between lytic growth and lysogeny.

  • Evolutionary relationships: The evolutionary history of Gene 1 protein across different Xanthomonas phages and how structural variations influence host range and phage behavior.

  • Therapeutic potential: Whether Gene 1 protein or derivatives could be developed into antimicrobial agents against Xanthomonas plant pathogens .

Addressing these questions will significantly advance our understanding of phage biology and potentially yield new biotechnological applications.

How might the evolution of phiLf Gene 1 protein across different Xanthomonas phages inform our understanding of phage-host coevolution?

Comparative genomic analysis reveals important evolutionary insights:

The phiLf phage genome shows evidence of horizontal gene transfer and recombination events with other phages. For instance, the phiL7 phage (which infects Xanthomonas campestris pv. campestris) shares some gene sequences with phiLf but also contains unique genes with varying G+C contents that form clusters dispersed along the genome .

This suggests that Gene 1 protein likely evolved through a combination of vertical inheritance and horizontal gene transfer between related phages. Studying the sequence and functional conservation of this protein across different Xanthomonas phages provides a window into the evolutionary pressures driving phage-host coevolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.