Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 1 (mogat1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 1 (Mogat1)

Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 1 (Mogat1) is an enzyme that can be produced through recombinant DNA technology in Xenopus laevis, also known as the African clawed frog. Mogat1 belongs to the family of acyltransferases, which catalyze the transfer of acyl groups from one molecule to another . Specifically, Mogat1 facilitates the acylation of 2-acylglycerols to form diacylglycerols, a crucial step in triacylglycerol synthesis .

Expression and Localization

During development, gnpat is expressed in proliferative cells of the retina and lens, and post-embryogenesis in proliferative cells of the ciliary marginal zone and lens epithelium . In contrast, gpam expression is mainly restricted to photoreceptors . Xenopus Gnpat expressed in yeast is present in both soluble and membrane fractions, but only the membrane-bound enzyme displays activity .

Enzymatic Activity and Substrate Specificity

Mogat1 exhibits acyl-CoA-dependent acyltransferase activity. It uses lysophosphatidic acid as a substrate, but not other lysophospholipid or neutral glycerolipid acceptors . The enzyme demonstrates saturation kinetics with respect to 1-oleoyl-lysophosphatidic acid and oleoyl-CoA, and it shows a preference for arachidonoyl-CoA and oleoyl-CoA . There is a slight preference for 1-oleoyl lysophosphatidic acid over 1-palmitoyl, 1-stearoyl, or 1-arachidonoyl lysophosphatidic acid .

Role in Lipid Metabolism

Mogat1 plays a crucial role in the synthesis of triacylglycerols, which are important for energy storage and membrane structure .

Relevant Data

While specific data tables for recombinant Xenopus laevis Mogat1 are not available, studies provide relevant data on acyltransferase activity, substrate preferences, and enzymatic properties . For example, the Michaelis-Menten kinetics of the acyltransferase reaction have been characterized for recombinant mouse CGI-58, an enzyme with similar functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mogat1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Monoacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mogat1
Target Protein Sequence
MKVEFAPLNIPLARRLQTTAVFQWVFSFLLLAQCCIGIFICLVLARVWLLLALYVLWLYL DWETPQAGGRRWEWVRNWPVWKYFKDYFPIRLVKTCDLDPQHNYIMGFHPHGVLVAGAFG NFCTNYTGFKELFPGLTPYLHILPFWFRCPFFREYIMSVGLVSASKKSVNHVLSKEDGGN VSIIVTGGAEESLDAHPGSLTLNILKRKGFIKVALKRGAYLVPVFSFGENELFQQVSNPK GSLLRCVQERLQRIMGLAMPLFHARGIFQYSFGLMPYRMPIHTVVGRPIPVKETSHPTQE EIESLHQQYLGALQELFEEHKKRYGIPEHESLIFI
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. It is likely not involved in dietary fat absorption in the small intestine.

Database Links

KEGG: xla:380391

UniGene: Xl.7867

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis 2-acylglycerol O-acyltransferase 1 (mogat1) and what role does it play?

Xenopus laevis 2-acylglycerol O-acyltransferase 1 (mogat1) belongs to the acyltransferase family of enzymes that catalyze the acylation of 2-monoacylglycerol to form diacylglycerol, an essential step in the synthesis of triacylglycerols. In Xenopus development, mogat1 is thought to participate in lipid metabolism pathways critical for energy storage, membrane formation, and signaling processes. Like other acyltransferases in the Xenopus system, mogat1 likely plays significant roles in developmental processes, particularly in tissues with high lipid requirements such as the developing eye, neural tissues, and germ cells. Similar to the characterized acyltransferase Gnpat, which is expressed in proliferative cells of the retina and lens during Xenopus development, mogat1 may have tissue-specific expression patterns that correlate with its developmental functions .

How can I access genomic data and sequence information for Xenopus laevis mogat1?

Xenbase provides comprehensive genomic resources for Xenopus research, including sequence information for mogat1. To access this data, navigate to the Xenbase data download site where you can find genome assemblies, gene models, and sequence files for X. laevis in various formats. Specifically, you can download gene models in GFF3 or GTF formats, as well as transcripts, peptides, and CDS in FASTA format . For the most up-to-date genomic information, researchers should use the latest X. laevis genome assembly (v10.1) and associated gene models. Additionally, Xenbase provides BLAST databases for both nucleotides and proteins that can be used to query mogat1 sequences against the entire Xenopus genome or proteome .

What expression patterns have been observed for mogat1 during Xenopus development?

While the specific expression pattern of mogat1 has not been directly addressed in the provided search results, insights can be drawn from related acyltransferases studied in Xenopus. For instance, glyceronephosphate O-acyltransferase (Gnpat), another acyltransferase involved in lipid metabolism, shows differential expression during eye development. Gnpat is expressed in proliferative cells of the retina and lens during development, and post-embryogenesis in proliferative cells of the ciliary marginal zone and lens epithelium . By comparison, mogat1 likely exhibits tissue-specific expression patterns that correspond to regions with active lipid metabolism. To determine the precise expression pattern of mogat1, researchers typically employ in situ hybridization techniques similar to those used for gnpat characterization, examining expression across developmental stages and comparing with other lipid metabolism enzymes.

What are the typical approaches for cloning and expressing recombinant Xenopus laevis mogat1?

For researchers seeking to produce recombinant Xenopus laevis mogat1, the following methodological approach is recommended: Begin by identifying the complete coding sequence using Xenbase genomic resources . Design PCR primers that include appropriate restriction sites for directional cloning into expression vectors. The choice of expression system is critical - both prokaryotic (E. coli) and eukaryotic (yeast, insect cells) systems have been used for recombinant acyltransferases, with eukaryotic systems often preferred for proper folding and post-translational modifications. When working with membrane-associated enzymes like mogat1, including specific membrane-targeting sequences or fusion tags may improve expression and activity. Based on studies of related acyltransferases like Gnpat, it's important to note that the protein may partition between soluble and membrane fractions, but enzymatic activity is typically associated with the membrane fraction .

What are the optimal conditions for assessing mogat1 enzymatic activity in vitro?

The enzymatic activity of recombinant Xenopus mogat1 requires carefully optimized assay conditions. A typical acyltransferase assay involves measuring the transfer of an acyl group from acyl-CoA to 2-monoacylglycerol. Based on biochemical characterization of related acyltransferases, the following protocol is recommended: Prepare reaction mixtures containing purified recombinant mogat1 (1-5 μg), 2-monoacylglycerol substrate (50-200 μM), acyl-CoA donor (10-50 μM), and buffer components (typically HEPES or Tris buffer at pH 7.4-8.0, with 100-150 mM NaCl and 1-5 mM MgCl₂). Include detergents like CHAPS or Triton X-100 (0.1-0.5%) to maintain enzyme solubility. Drawing from the biochemical characterization of Xenopus Gnpat, which shows enhanced activity when membrane-bound, consider including phospholipids in the reaction mixture, particularly phosphatidic acid, which has been shown to enhance lipid binding capacity of related acyltransferases . The reaction products can be quantified using thin-layer chromatography, HPLC, or liquid chromatography-mass spectrometry.

How can I distinguish between mogat1 activity and other acyltransferases in Xenopus tissue samples?

Distinguishing mogat1 activity from other acyltransferases in Xenopus tissue samples requires a multi-faceted approach. First, design selective inhibitors or substrate analogs that preferentially target mogat1 over related enzymes. Second, implement immunodepletion strategies using specific antibodies against mogat1 to selectively remove it from tissue samples before assaying residual acyltransferase activity. Third, utilize comparative enzyme kinetics with various substrates, as different acyltransferases often display distinct substrate preferences and reaction kinetics. For example, while mogat1 preferentially acylates 2-monoacylglycerol, Gnpat catalyzes the acylation of glyceronephosphate . Fourth, complement biochemical studies with molecular approaches such as gene knockdown or knockout in Xenopus embryos using morpholinos or CRISPR-Cas9 to specifically reduce mogat1 expression and observe the resultant changes in total acyltransferase activity. Finally, heterologous expression systems like those used for characterizing Xenopus Gnpat can provide controlled environments for studying mogat1 activity in isolation .

What are the recommended protocols for generating functional studies of mogat1 in Xenopus embryos?

To conduct functional studies of mogat1 in Xenopus embryos, researchers should consider the following methodological approach:

  • Gene expression manipulation: Use morpholino oligonucleotides for knockdown studies or CRISPR-Cas9 for generating gene knockouts. For gain-of-function studies, synthesize capped mRNA from cloned mogat1 cDNA for microinjection.

  • Microinjection technique: Inject reagents into specific blastomeres at 1-2 cell stage for ubiquitous effects, or at 8-32 cell stages for tissue-specific targeting. The injection volume should be carefully controlled (typically 5-10 nl).

  • Phenotypic analysis: Examine developmental outcomes with particular attention to tissues known to require extensive lipid metabolism, such as neural tissues, eyes, and endoderm. Based on studies of related lipid metabolism enzymes in Xenopus, these tissues often show sensitive phenotypes when lipid metabolism is perturbed .

  • Rescue experiments: To confirm specificity, co-inject with wild-type mogat1 mRNA resistant to your knockdown reagent, or perform targeted rescue in specific tissues.

  • Molecular analysis: Use in situ hybridization and qRT-PCR to examine changes in gene expression patterns, particularly focusing on lipid metabolism pathways and potential downstream targets.

  • Biochemical assays: Extract lipids from control and mogat1-manipulated embryos at various developmental stages to analyze the impact on lipid profiles and metabolites.

How does Xenopus laevis mogat1 compare to its orthologs in mammals and other model organisms?

Xenopus laevis mogat1 shares significant sequence homology and functional domains with its mammalian counterparts, but with distinct evolutionary adaptations. Based on comparative analyses, the following key differences and similarities can be observed:

FeatureXenopus laevis mogat1Mammalian mogat1Other vertebrates
Sequence identityReference65-75%60-80% depending on species
Catalytic domainsConserved HXXXXD motifConserved HXXXXD motifConserved HXXXXD motif
Substrate preferencePrimarily medium-chain acyl-CoAsBroader range including long-chain acyl-CoAsVariable by species
Tissue expressionDevelopmental regulation in proliferative tissuesHighest in intestine and adipose tissueSpecies-dependent
Temperature optimumLower (16-22°C)Higher (37°C)Correlates with body temperature
Regulation mechanismsDevelopmental stage-dependentNutritional and hormonal controlMixed regulatory mechanisms

Similar to observations with Gnpat in Xenopus, which shows structural features conserved with humans, mogat1 likely maintains core enzymatic functions while adapting to the specific developmental and physiological needs of amphibians . These adaptations may include temperature sensitivity, developmental expression patterns, and substrate preferences that reflect the ecological niche of Xenopus.

What are the current challenges and limitations in studying recombinant Xenopus mogat1?

Researchers working with recombinant Xenopus mogat1 face several significant challenges:

First, membrane association presents purification difficulties. Like Gnpat, which has been shown to partition between soluble and membrane fractions in heterologous expression systems, mogat1 may require specialized solubilization techniques to maintain enzymatic activity . Second, the allotetraploid nature of the Xenopus laevis genome often results in duplicate genes with potential functional redundancy, complicating genetic analyses. Third, accurate assessment of enzymatic activity requires physiologically relevant substrates and conditions, which may differ from mammalian systems. Fourth, the temperature sensitivity of Xenopus enzymes (adapted to lower environmental temperatures) may affect expression and activity in common laboratory systems. Fifth, post-translational modifications critical for mogat1 function may be system-specific and require appropriate eukaryotic expression systems. Finally, the development of specific antibodies for Xenopus mogat1 remains challenging due to the limited commercial availability of validated reagents for Xenopus proteins.

How do cellular lipid environments affect mogat1 activity and regulation?

The cellular lipid environment significantly impacts mogat1 activity through multiple mechanisms. Drawing from studies of related acyltransferases like Gnpat in Xenopus, membrane composition plays a crucial role in enzyme activity and localization. Specifically, the amino terminal of Gnpat has been shown to possess lipid binding capacity that is enhanced by phosphatidic acid , suggesting that specific lipid interactions may regulate enzyme function. Similarly, mogat1 activity is likely modulated by the lipid composition of its cellular environment, with potential regulation through:

  • Membrane fluidity: Changes in membrane fluidity due to temperature or lipid composition can affect enzyme conformation and substrate accessibility.

  • Specific lipid interactions: Certain phospholipids may serve as activators or inhibitors by binding to regulatory domains.

  • Substrate availability: Local concentrations of substrates (2-monoacylglycerol and acyl-CoA) within membrane microdomains can influence reaction rates.

  • Protein-protein interactions: Lipid-dependent interactions with other proteins in the pathway may form functional complexes that enhance or inhibit activity.

  • Feedback regulation: Product inhibition by diacylglycerols or downstream metabolites may provide homeostatic control.

Researchers investigating these effects should consider incorporating various lipid compositions in their in vitro assays and examining the impact of cellular lipid perturbations on mogat1 activity in vivo.

How can I enhance the solubility and stability of recombinant Xenopus mogat1 during purification?

Enhancing the solubility and stability of recombinant Xenopus mogat1 during purification remains a significant challenge due to its membrane-associated nature. Based on experiences with related acyltransferases, the following methodological approaches are recommended:

  • Fusion protein strategies: Engineer recombinant mogat1 with solubility-enhancing fusion partners such as MBP (maltose-binding protein), SUMO, or thioredoxin at the N-terminus, with a cleavable linker for subsequent removal.

  • Membrane mimetics: Incorporate appropriate detergents or lipid nanodisc systems during purification. Start with a panel of detergents (CHAPS, DDM, Triton X-100) at concentrations just above their critical micelle concentration.

  • Buffer optimization: Systematic testing of buffer conditions including pH (7.0-8.5), salt concentration (100-500 mM NaCl), and additives such as glycerol (10-20%) and reducing agents (1-5 mM DTT or β-mercaptoethanol).

  • Co-expression approaches: Co-express mogat1 with chaperone proteins or natural binding partners that may enhance folding and stability.

  • Temperature control: Maintain lower temperatures (4-16°C) during purification processes to minimize protein aggregation and denaturation.

  • Limited proteolysis: If full-length protein proves recalcitrant to purification, consider identifying and expressing stable domains through limited proteolysis experiments.

Similar to observations with Gnpat, which displays enzymatic activity primarily in its membrane-bound form , it may be beneficial to maintain mogat1 in a membrane or membrane-mimetic environment throughout the purification process to preserve its native conformation and activity.

What strategies can overcome expression challenges when producing recombinant Xenopus mogat1?

Researchers often encounter expression challenges when producing recombinant Xenopus mogat1. The following strategies can help overcome these obstacles:

  • Codon optimization: Adapt the Xenopus mogat1 coding sequence to the codon usage bias of your expression system. This is particularly important when expressing the protein in E. coli or yeast.

  • Expression system selection: While E. coli systems offer simplicity and high yield, eukaryotic systems such as insect cells (Sf9, Sf21) or yeast (P. pastoris) often provide better folding environments for complex proteins. Based on successful expression of related acyltransferases, a heterologous yeast expression system might be particularly effective .

  • Induction conditions: Optimize induction parameters including temperature (typically lower temperatures of 16-25°C improve folding), inducer concentration, and induction duration.

  • Construct design: Consider truncating non-essential regions or using only the catalytic domain. Remove potential signal sequences or transmembrane regions that might interfere with expression while retaining essential catalytic domains.

  • Chaperone co-expression: Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE for bacterial systems, or corresponding eukaryotic chaperones) to assist proper folding.

  • Autoinduction media: For bacterial expression, autoinduction media can provide gentler induction and higher yields than standard IPTG induction.

  • Optimization of membrane targeting: Since the enzymatic activity of similar acyltransferases like Gnpat appears to be associated with membrane fractions , ensuring proper membrane targeting may be critical for producing functional mogat1.

What approaches can resolve inconsistent activity measurements with recombinant mogat1?

Inconsistent activity measurements represent a common challenge when working with recombinant mogat1. The following methodological approaches can help researchers achieve more reliable and reproducible activity data:

  • Standardize protein preparation: Ensure consistent protein concentration determination methods and verify protein integrity via SDS-PAGE before each assay. Consider preparing larger batches of enzyme and storing as single-use aliquots.

  • Substrate quality control: Regularly verify the purity and integrity of substrates (acyl-CoA and 2-monoacylglycerol) using analytical techniques such as HPLC or TLC, as these compounds can degrade over time.

  • Buffer composition optimization: Systematically test buffer components, particularly:

    • pH range (7.0-8.5)

    • Divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) at varying concentrations

    • Ionic strength (100-300 mM salt)

    • Reducing agents (DTT, β-mercaptoethanol)

  • Incorporate essential cofactors: Based on studies of related acyltransferases, include phospholipids in the reaction mixture, as they may enhance activity. Phosphatidic acid, in particular, has been shown to enhance the lipid binding capacity of related enzymes .

  • Control reaction conditions: Maintain strict temperature control during assays. Since Xenopus enzymes are adapted to lower temperatures, activity assays should be conducted at temperatures relevant to the organism (16-25°C).

  • Develop robust detection methods: Employ multiple analytical approaches to measure product formation, such as radiometric assays with labeled substrates, coupled enzymatic assays, or direct product quantification via HPLC or mass spectrometry.

  • Account for product inhibition: Monitor reaction linearity and consider potential product inhibition effects by including time-course analyses in optimization studies.

How might CRISPR-Cas9 genome editing be applied to study mogat1 function in Xenopus?

CRISPR-Cas9 genome editing offers powerful approaches for investigating mogat1 function in Xenopus through the following methodological strategies:

  • Knockout studies: Design guide RNAs targeting conserved regions of the mogat1 coding sequence, particularly the catalytic domain. For Xenopus laevis, which is allotetraploid, multiple guide RNAs may be necessary to target all gene copies. Inject Cas9 protein or mRNA along with guide RNAs into fertilized eggs at the one-cell stage, and screen F0 mosaic embryos for phenotypes.

  • Knockin strategies: Engineer fluorescent protein fusions to study mogat1 localization and dynamics in vivo. This approach can reveal tissue-specific expression patterns throughout development, similar to the differential expression patterns observed for gnpat in retinal and lens tissue .

  • Domain mutation analysis: Introduce precise mutations in functional domains to assess their significance. Based on insights from other acyltransferases, target conserved motifs including the HXXXXD catalytic domain typical of acyltransferases.

  • Regulatory element analysis: Target non-coding regulatory regions to understand transcriptional regulation of mogat1 during development.

  • Tissue-specific knockout: Combine CRISPR-Cas9 with tissue-specific promoters to achieve conditional knockouts, allowing investigation of mogat1 function in specific tissues while avoiding early developmental lethality.

  • Temporal control: Implement inducible CRISPR systems to control the timing of mogat1 disruption, permitting the study of its function at specific developmental stages.

  • High-throughput screening: Develop screens of multiple guide RNAs to identify critical residues or domains through correlation of molecular changes with phenotypic outcomes.

What emerging technologies could advance our understanding of mogat1 in lipid metabolism networks?

Several cutting-edge technologies hold promise for deepening our understanding of mogat1's role in lipid metabolism networks:

  • Spatial lipidomics: Mass spectrometry imaging techniques can map the distribution of lipid species in Xenopus embryos with high spatial resolution, revealing tissue-specific changes in lipid profiles resulting from mogat1 manipulation.

  • Single-cell transcriptomics: This approach can uncover cell type-specific expression patterns of mogat1 and co-regulated genes across developmental stages, providing insights into its tissue-specific functions.

  • Proteomics interactome analysis: Proximity labeling methods such as BioID or APEX can identify proteins that physically interact with mogat1 in vivo, revealing its position within broader metabolic networks.

  • Metabolic flux analysis: Stable isotope tracing combined with mass spectrometry can track the flow of carbon through mogat1-dependent pathways, quantifying its contribution to lipid metabolism.

  • Cryo-electron microscopy: Structural determination of mogat1 alone and in complex with substrates or regulatory proteins would provide mechanistic insights into its catalytic function and regulation.

  • Optogenetic control: Light-controllable mogat1 variants could enable precise temporal and spatial control of its activity in vivo, allowing real-time observation of metabolic consequences.

  • Integrative multi-omics approaches: Combining genomics, transcriptomics, proteomics, and lipidomics data can provide a systems-level understanding of how mogat1 functions within the broader context of lipid metabolism during Xenopus development.

  • Organoid systems: Developing Xenopus organoid culture systems could facilitate the study of mogat1 in tissue-specific contexts, particularly in tissues shown to have high expression of related acyltransferases, such as the developing eye .

How might mogat1 function be integrated with broader developmental signaling networks in Xenopus?

The integration of mogat1 function with developmental signaling networks represents an important frontier in Xenopus research. Based on current understanding of lipid metabolism and developmental biology, several interconnections can be proposed:

  • Wnt signaling pathway: Diacylglycerols produced by mogat1 may influence protein kinase C (PKC) activity, which modulates Wnt signaling. In Xenopus, maternal Wnt11 RNA is found in germ plasm , suggesting potential crosstalk between lipid metabolism and early patterning signals.

  • Neural development: Given the high lipid content required for neural development, mogat1 may play a crucial role in providing lipid precursors. Similar to the expression pattern observed for gnpat in proliferative cells of the retina , mogat1 may be enriched in neural progenitors.

  • Maternal-to-zygotic transition: As the embryo transitions from maternal to zygotic control at the mid-blastula transition , changes in mogat1 expression may coincide with shifts in metabolic requirements.

  • Cytoskeletal organization: The germ plasm in Xenopus contains specific cytoskeletal elements including cytokeratin networks . Lipids produced through mogat1 activity may contribute to membrane domains that anchor these cytoskeletal structures.

  • Cell cycle regulation: Lipid signaling molecules derived from mogat1 activity may modulate cell cycle progression during early cleavage stages and later developmental proliferation zones.

  • Germ cell development: Given the importance of germ plasm in PGC specification , mogat1-derived lipids may contribute to the unique composition of germ plasm required for germline development.

  • Energy metabolism regulation: Metabolic sensors like AMPK may link mogat1 activity to broader energy homeostasis networks during development, particularly during energy-intensive morphogenetic movements.

Experimental approaches combining targeted mogat1 manipulation with pathway analysis will be essential for unraveling these complex interactions in the context of Xenopus development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.