Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 2-A (mogat2-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your use.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mogat2-a; 2-acylglycerol O-acyltransferase 2-A; Acyl-CoA:monoacylglycerol acyltransferase 2-A; MGAT2-A; Monoacylglycerol O-acyltransferase 2-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mogat2-a
Target Protein Sequence
MKIQFAPHNVPFERRLQTAAVLQWVFSFLALAQTCILLFFVLLFTRFWIISVVYGVWWFL DWDTPSKGGRRGEWLRRHVIWTYMKDYFPITLVKTADLDPQQNYVVGSHPHGVLVAGAFT NFCTEATGFHRLFPGITPYLLMLPLWFRAPFFRDYIMSGGLIPSDKDSASYLLKNKAGGN AVVIAVGGAPESLDARPGAFTLLIKNRKGFVRLAILHGASLVPVFSFGENELFDQVDNPR GSWLRKIQEKLQKMMGVALPLFHARGVFQYSFGLIPYRKPIATIVGKPIRVEENPNPSSE EVDKLHKIYMEELSKLFEEHKTKYNVPADKHLTFV
Uniprot No.

Target Background

Function

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.

Database Links

KEGG: xla:735031

UniGene: Xl.53818

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is the basic characterization of Xenopus laevis mogat2-a protein?

Xenopus laevis 2-acylglycerol O-acyltransferase 2-A (mogat2-a) is a full-length protein consisting of 335 amino acids with EC number 2.3.1.22. The protein is also known by several synonyms including Acyl-CoA:monoacylglycerol acyltransferase 2-A, MGAT2-A, and Monoacylglycerol O-acyltransferase 2-A. Its UniProt ID is Q2KHS5, which serves as the standard reference for protein characterization and sequence information across databases.

How does the mogat2-a protein from Xenopus laevis compare structurally to mammalian homologs?

While the search results don't provide direct comparison data, structural biology approaches can be used to compare Xenopus laevis mogat2-a with mammalian homologs. Researchers should perform sequence alignment analyses to identify conserved catalytic domains and species-specific variations. Such comparative analyses are crucial for understanding evolutionary conservation of MGAT2 function across species and for selecting appropriate experimental models. When designing cross-species studies, researchers should account for potential differences in post-translational modifications that may affect protein function and regulation.

What are the optimal conditions for recombinant expression of mogat2-a?

The recombinant Xenopus laevis mogat2-a protein can be successfully expressed in E. coli expression systems. For optimal results, the full-length protein (1-335 amino acids) can be expressed with an N-terminal His-tag to facilitate purification. Expression in E. coli provides sufficient yields for most biochemical and functional analyses. Researchers should optimize induction conditions (IPTG concentration, temperature, and duration) to maximize protein yield while maintaining proper folding.

What purification strategies yield the highest purity mogat2-a preparations?

Standard purification protocols for His-tagged recombinant mogat2-a include:

  • Initial capture using nickel affinity chromatography

  • Buffer exchange to remove imidazole

  • Secondary purification steps (ion exchange or size exclusion chromatography)

This approach typically yields preparations with greater than 90% purity as determined by SDS-PAGE analysis. For applications requiring ultrapure protein, additional chromatography steps may be necessary. Quality control should include verification of purity by SDS-PAGE and activity assessment using enzymatic assays.

What are the recommended storage conditions to maintain mogat2-a stability and activity?

Storage PeriodRecommended ConditionsAdditional Measures
Short-term (≤1 week)4°CWorking aliquots in appropriate buffer
Medium-term-20°CWith 50% glycerol
Long-term-80°CAliquoted to avoid freeze-thaw cycles

For optimal stability, recombinant mogat2-a should be stored in Tris/PBS-based buffer containing protective agents such as 50% glycerol or 6% trehalose at pH 8.0. The protein should be aliquoted to avoid repeated freeze-thaw cycles, which significantly reduce enzyme activity. When reconstituting lyophilized protein, centrifugation of the vial prior to opening is recommended, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

What assays are most appropriate for measuring mogat2-a enzymatic activity?

Enzymatic activity of mogat2-a (EC 2.3.1.22) can be assessed using several complementary approaches:

  • Radiochemical assay: Measuring the incorporation of radiolabeled acyl-CoA into diacylglycerol using thin-layer chromatography

  • Spectrophotometric assay: Monitoring the release of CoA through coupling with dithionitrobenzoic acid (DTNB)

  • HPLC-based methods: Quantifying reaction products directly

When designing activity assays, researchers should consider substrate specificity, optimal pH (typically 7.4-8.0), and potential inhibitors. Control experiments should include heat-inactivated enzyme and competitive inhibitors to validate assay specificity.

How is mogat2-a function related to lipid metabolism pathways?

Research with mogat2 knockout mice has revealed significant insights into the role of this enzyme in lipid metabolism. Mogat2-/- mice exhibit 10-15% higher metabolic rates compared to wild-type littermates, indicating a key role in energy homeostasis. This increased metabolic activity persists even on a fat-free diet, suggesting that mogat2's influence extends beyond dietary fat processing.

The relationship between mogat2 activity and lipid metabolism includes:

  • Acylation of monoacylglycerol to form diacylglycerol, a critical intermediate in triacylglycerol synthesis

  • Regulation of postprandial lipid absorption and processing

  • Influence on whole-body energy expenditure and oxygen consumption

These functions highlight mogat2's importance as a potential therapeutic target for metabolic disorders.

What is the impact of mogat2 deficiency on metabolic parameters in animal models?

Studies with mogat2-deficient mice demonstrate significant metabolic phenotypes:

ParameterWild-type MiceMogat2-/- MiceSignificance
Oxygen consumptionBaseline8-13% increasep<0.05
Response to high-fat dietWeight gainResistance to obesityp<0.05
Metabolic rateBaseline10-15% increasep<0.05
Dark phase O₂ consumptionBaseline7.4% higher on chow dietp<0.05

Mogat2-/- mice maintain similar body weight despite varying dietary fat content, whereas wild-type mice gain weight progressively with increased dietary fat. Interestingly, heterozygous Mogat2+/- mice show an intermediate phenotype, indicating a gene-dose effect. The resistance to weight gain in knockout mice is primarily due to differences in fat mass, with lean body mass remaining comparable between genotypes.

How should researchers design experiments to investigate mogat2-a function in Xenopus models?

When designing experiments to investigate mogat2-a function in Xenopus models, researchers should consider:

  • Developmental timing: Assess expression patterns throughout embryonic development using quantitative PCR and in situ hybridization

  • Tissue specificity: Examine mogat2-a distribution across tissues with particular focus on liver, intestine, and adipose tissue

  • Loss-of-function approaches: Employ morpholinos or CRISPR/Cas9 for targeted gene knockdown/knockout

  • Gain-of-function studies: Use mRNA overexpression to assess phenotypic consequences

  • Metabolic parameters: Measure lipid accumulation, energy expenditure, and metabolic rates in manipulated animals

Controls should include dose-response analyses for interventions and rescue experiments to confirm specificity of observed phenotypes.

What are the key considerations when comparing mogat2-a function across different species?

When conducting comparative studies of mogat2 function:

  • Sequence homology analysis: Determine conservation of catalytic domains and regulatory regions

  • Expression pattern comparison: Assess tissue-specific expression profiles across species

  • Functional conservation testing: Compare enzymatic activities using identical substrate conditions

  • Physiological relevance: Evaluate metabolic phenotypes in species-appropriate contexts

  • Evolutionary interpretation: Consider differences in dietary adaptation and metabolic requirements

These approaches help distinguish conserved functions from species-specific adaptations, which is crucial for translating findings from Xenopus to mammalian systems or potential therapeutic applications.

How can researchers effectively investigate the relationship between mogat2-a and obesity resistance?

Based on findings from mogat2 knockout mice, researchers investigating the relationship between mogat2-a and obesity resistance should design experiments that:

  • Examine oxygen consumption and energy expenditure under various dietary conditions

  • Measure respiratory exchange ratio (RER) to determine substrate utilization patterns

  • Implement pair-feeding studies to distinguish between food intake and energy expenditure effects

  • Analyze tissue-specific lipid accumulation and utilization

  • Investigate compensatory metabolic pathways that may be upregulated in mogat2-deficient conditions

Research demonstrates that mogat2-/- mice maintain increased oxygen consumption relative to wild-type mice across various dietary fat contents (10%, 45%, and 60% of calories from fat). This difference is most pronounced during the dark phase when mice are active and feeding, indicating a sustained metabolic advantage that prevents weight gain even with high-fat diets.

How can structural analysis of mogat2-a inform the design of specific inhibitors?

Advanced structural analysis of mogat2-a can guide rational inhibitor design through:

  • Homology modeling: Using the amino acid sequence to predict three-dimensional structure

  • Active site mapping: Identifying catalytic residues through site-directed mutagenesis

  • Virtual screening: In silico docking of potential inhibitors to predicted binding pockets

  • Structure-activity relationship studies: Systematic modification of lead compounds to enhance potency and selectivity

These approaches can yield targeted inhibitors for research applications and potential therapeutic development, particularly for metabolic disorders like obesity and diabetes.

What are the methodological challenges in translating mogat2-a research from Xenopus to mammalian systems?

Translational research involving mogat2-a faces several methodological challenges:

  • Evolutionary divergence: Differences in protein sequence and regulation between amphibian and mammalian systems

  • Metabolic adaptations: Species-specific differences in lipid metabolism and energy homeostasis

  • Experimental model limitations: Differences in developmental programs and tissue architecture

  • Compensatory mechanisms: Varying redundancy in metabolic pathways across species

Researchers can address these challenges through careful comparative analyses, validation in multiple model systems, and consideration of species-specific metabolic contexts when interpreting results.

How does mogat2-a activity potentially intersect with other metabolic regulatory pathways?

The metabolic impact of mogat2 extends beyond simple lipid processing, suggesting complex pathway interactions:

  • Energy expenditure regulation: Mogat2-/- mice show increased energy expenditure independent of dietary fat content, indicating interaction with central metabolic regulatory circuits

  • Substrate utilization flexibility: Differential responses to varying dietary compositions suggest crosstalk with carbohydrate metabolism

  • Circadian influences: The enhanced effect during dark/active phases points to temporal regulation of metabolic pathways

  • Compensatory lipid absorption: Despite mogat2 deficiency, mice maintain normal fat absorption, indicating alternative pathways

Research approaches to investigate these interactions should incorporate transcriptomic and metabolomic analyses to identify affected pathways, as well as tissue-specific conditional knockout models to pinpoint sites of action.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.