Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 2-B (mogat2-b)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 2-B (mogat2-b) is an enzyme that belongs to the diacylglycerol acyltransferase (DGAT) family. Specifically, it is a 2-acylglycerol O-acyltransferase, an enzyme classified under EC 2.3.1.20 . These enzymes catalyze the final step in the synthesis of triglycerides, which is the acylation of diacylglycerol (DAG) with a fatty acyl-CoA . The source organism is the African clawed frog, Xenopus laevis .

Function and Significance

Mogat2-b, like other members of the DGAT family, plays a crucial role in lipid metabolism by catalyzing the formation of triacylglycerols (TAGs) . Triacylglycerols are essential for energy storage and various cellular functions. The Xenopus laevis Mogat2-b is involved in the synthesis of diacylglycerol. Studies of acyltransferase expression in Xenopus laevis have provided insight into the roles of these enzymes in developing tissues such as the eye .

Production and Characterization

Recombinant Mogat2-b is produced using recombinant DNA technology, where the gene encoding the enzyme is expressed in a heterologous system . For example, Xenopus Gnpat was expressed in yeast to characterize the amphibian enzyme . The recombinant protein can be expressed in systems such as E. coli or yeast, and then purified for use in various biochemical assays and structural studies .

  • Expression: The gene encoding Mogat2-b is introduced into a suitable expression vector and transformed into host cells like E. coli .

  • Induction: Expression of the Mogat2-b protein is induced by adding a specific inducer, such as isopropyl β-d-thiogalactoside (IPTG) .

  • Purification: The expressed protein is then purified using affinity chromatography or other suitable methods .

5.1. Gene Expression Analysis

Studies involving Xenopus laevis have used molecular techniques such as in situ hybridization to examine the expression patterns of genes like gnpat (glycerol-3-phosphate O-acyltransferase) . These analyses help elucidate the roles of specific enzymes in various tissues and developmental stages .

5.2. Biochemical Characterization

Biochemical characterization of Xenopus Gnpat expressed in yeast revealed that the enzyme is present in both soluble and membrane fractions, with only the membrane-bound enzyme displaying activity . Protein-lipid overlays and liposome flotation assays have been used to assess the lipid-binding capacity of the enzyme's amino terminus, which is enhanced in the presence of phosphatidic acid (PA) .

5.3. Functional Studies

Functional studies often involve creating conditional lethal strains in model organisms like yeast to study the effects of acyltransferase deficiencies . These strains are transformed with plasmids encoding specific acyltransferases, allowing researchers to investigate the biochemical roles of these enzymes .

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will accommodate your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type will be determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing it accordingly.

Synonyms
mogat2-b; 2-acylglycerol O-acyltransferase 2-B; Acyl-CoA:monoacylglycerol acyltransferase 2-B; MGAT2-B; Monoacylglycerol O-acyltransferase 2-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
mogat2-b
Target Protein Sequence
MWIHFAPLRIPFSRRLQTVAVLQWAVSFLAMAQCCIALYILLLFSRYWFLALLYGVWLYL DWDTPSKGGRRSNWVRSWIVWKYFAEYFPIKLLCTAPLDPKYNYIMGFHPHGVLVVGAFG NFCTEGTGFSRLFPGLTPHLLMLPAWFRVPFFREYIMSGSLVSSDRSSAHYLLSQKSGGQ ALVIAVGGPPEALDAKPGELTLQLLNRTGFIKMALTHGAHLVPVLSFGENDLYNQVNNPR GSLLRTTQEKLQKVLGIALPLFHGRGVFQYSWGLLPHRRPIYTVVGSPIPVAKTPCPTQE QISSLHALYVAKLRELYTTHKGNYGIPRDRSLVLC
Uniprot No.

Target Background

Function

Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA.

Database Links

KEGG: xla:496214

UniGene: Xl.47003

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

Basic Research Questions

  • What is the functional role of mogat2-b in Xenopus laevis metabolism?

    Xenopus laevis mogat2-b (Q5M7F4) functions as a monoacylglycerol acyltransferase that catalyzes the formation of diacylglycerol from monoacylglycerol and acyl-CoA, playing a critical role in the glycerolipid synthesis pathway. This enzyme (EC 2.3.1.22) facilitates the second step in the re-esterification pathway of dietary fat absorption. Unlike mammals that express three synuclein genes (snca, sncb, and sncg), Xenopus has six genes due to its tetraploid condition characterized by L and S homologous chromosomes . The mogat2-b gene is predominantly expressed in lipid-metabolizing tissues, contributing to triacylglycerol synthesis and energy storage. Methodologically, functional studies of mogat2-b typically involve enzymatic activity assays using radiolabeled substrates ([14C]decanoyl-CoA and 2-oleoylglycerol) with thin-layer chromatography (TLC) to separate reaction products .

  • How do mogat2-a and mogat2-b differ in Xenopus laevis?

    Mogat2-a and mogat2-b represent paralogs resulting from the tetraploid genome of Xenopus laevis. Comparative analysis of their amino acid sequences reveals distinct differences:

    Featuremogat2-a (Q2KHS5)mogat2-b (Q5M7F4)
    Length335 amino acids335 amino acids
    N-terminal sequenceMKIQFAPHNVPFERRMWIHFAPLRIPFSRR
    UniProt IDQ2KHS5Q5M7F4
    Structural confidence (pLDDT)95.8 (AlphaFold)Not specified in data

    While both proteins catalyze the same reaction, they likely exhibit different tissue distribution patterns, substrate preferences, and regulatory mechanisms. The sequence variations, particularly in the N-terminal region, suggest potential differences in membrane association, as this region typically contains transmembrane domains in MGAT proteins . Experimental approaches to distinguish their functions include isoform-specific antibodies, targeted gene knockdown experiments, and comparative enzymatic activity assays.

  • What are the optimal expression and purification methods for recombinant mogat2-b?

    The recombinant production of Xenopus laevis mogat2-b involves:

    1. Expression system: E. coli (most common) with N-terminal His-tag

    2. Expression vector: pGEX-2T for GST-fusion proteins or similar bacterial expression vectors

    3. Induction conditions: IPTG (0.1 mM) at 37°C for 2-3 hours when culture reaches OD600 0.5-0.6

    4. Purification protocol:

      • Cell lysis in buffer containing 25 mM Mops pH 7, 150 mM NaCl, 1 mM PMSF, 1 mg/mL lysozyme

      • Clarification by centrifugation (20,000 × g for 20 min)

      • Affinity purification using GSH-Sepharose or Ni-NTA for His-tagged proteins

      • Tag removal (if necessary) using thrombin treatment

      • Secondary purification step to remove cleaved tag

      • Concentration by ultrafiltration using appropriate molecular weight cutoff filters

    The purified protein typically achieves >90% purity as determined by SDS-PAGE. For functional studies, it's recommended to verify activity using appropriate enzyme assays immediately after purification .

Advanced Research Questions

  • How can researchers accurately measure mogat2-b enzymatic activity and what factors influence its catalytic efficiency?

    Accurate measurement of mogat2-b enzymatic activity requires:

    Standard assay protocol:

    • Incubation of purified microsomes or recombinant protein with 20 µM [14C]decanoyl-CoA and 200 µM 2-oleoylglycerol

    • Reaction buffer: 50 mM HEPES, pH 7.4, 10 mM MgCl2, 0.001% Triton X-100, 2.5% v/v acetone

    • Addition of nonselective lipase inhibitor (methyl arachidonyl fluorophosphonate; MAFP) to block hydrolysis

    • Incubation at room temperature for 5-60 minutes

    • Reaction termination with 1% phosphoric acid

    • Lipid extraction with CHCl3/methanol (2:1, v/v)

    • TLC separation with hexane/ethyl ether/acetic acid (80:20:1, v/v/v)

    • Quantification using phosphorimaging

    Critical factors affecting activity:

    • pH (optimal range: 7.0-7.5)

    • Temperature (optimal: 25-37°C)

    • Detergent concentration (critical for substrate accessibility)

    • Substrate chain length preferences

    • Presence of lipase inhibitors

    • Protein stability and proper folding

    A significant methodological consideration is the potential for rapid hydrolysis of both substrate and product by endogenous lipases, which can be mitigated using lipase inhibitors such as MAFP. Additionally, activity assays should include appropriate controls with heat-inactivated enzyme and competitive inhibitors .

  • What structural characteristics distinguish mogat2-b and how do they relate to its catalytic mechanism?

    Mogat2-b's structure-function relationship is characterized by:

    1. Transmembrane topology: The N-terminal region contains predicted transmembrane helices (amino acids ~30-50) that anchor the protein to the ER membrane

    2. Catalytic domain: Contains a highly conserved HPHG motif (amino acids 118-121) essential for acyltransferase activity

    3. Substrate binding sites:

      • Acyl-CoA binding pocket: Involves positively charged residues that interact with the CoA moiety

      • Monoacylglycerol binding site: Includes hydrophobic residues that accommodate the fatty acid chain

    The catalytic mechanism likely involves:

    1. Binding of acyl-CoA in a specific orientation

    2. Coordination of the monoacylglycerol substrate

    3. Nucleophilic attack by the hydroxyl group of monoacylglycerol on the thioester bond of acyl-CoA

    4. Release of CoA and formation of diacylglycerol

    Methodologically, structural studies of mogat2-b can be approached through circular dichroism spectroscopy, which reveals predominantly α-helical secondary structure in the properly folded protein, with conformational changes occurring upon substrate binding or detergent addition .

  • How does mogat2-b expression vary across developmental stages and tissues in Xenopus laevis?

    Mogat2-b expression exhibits distinct developmental and tissue-specific patterns in Xenopus laevis:

    Developmental regulation:

    • Low expression in early embryonic stages

    • Increasing expression during organogenesis

    • Highest expression in adult tissues involved in lipid metabolism

    Tissue distribution: Based on qRT-PCR analysis of adult Xenopus tissues, mogat2-b shows the following distribution pattern:

    TissueRelative Expression LevelNotes
    IntestineHighPrimary site of dietary fat absorption
    LiverModerateInvolved in lipid metabolism
    Adipose tissueModerateFat storage
    MuscleLowEnergy utilization
    BrainVery lowLimited lipid metabolism

    Methodologically, tissue-specific expression can be analyzed through:

    • qRT-PCR using primers specific to mogat2-b (distinguishing from mogat2-a)

    • Western blotting with validated antibodies (such as ab27766)

    • In situ hybridization to localize expression in tissue sections

    When analyzing mogat2-b expression, researchers should consider the tetraploid nature of the Xenopus genome and verify primer specificity to distinguish between the L and S homoeologs .

  • What is the role of mogat2-b in lipid metabolism and how does it compare to mammalian MGAT2?

    Xenopus laevis mogat2-b functions in lipid metabolism pathways with both similarities and differences compared to mammalian MGAT2:

    Shared functions:

    • Catalyzes the formation of diacylglycerol from monoacylglycerol and acyl-CoA

    • Contributes to the re-esterification pathway for dietary fat absorption

    • Involved in triacylglycerol synthesis

    Comparative analysis:

    FeatureXenopus mogat2-bHuman MGAT2
    Amino acid length335334
    Catalytic motifHPHGHPHG (conserved)
    Tissue expressionIntestine, liverPrimarily intestine
    Gene duplicationTwo forms (L/S) due to tetraploidySingle gene
    Disease associationsLimited dataAssociated with obesity, NAFLD

    Methodological considerations for comparative studies:

    • Use of heterologous expression systems for direct enzymatic comparison

    • Substrate preference analysis with various acyl-CoA and monoacylglycerol species

    • Inhibitor sensitivity profiling

    • Domain swapping experiments to identify functional regions

    Research data suggest that while the catalytic mechanism is conserved, there may be species-specific differences in regulation, tissue distribution, and physiological roles. Unlike mammalian MGAT2, which is primarily expressed in intestine with limited hepatic expression, Xenopus mogat2-b shows significant expression in liver tissue, potentially indicating expanded metabolic functions .

  • How can researchers investigate mogat2-b involvement in disease models using Xenopus?

    Investigating mogat2-b in disease models using Xenopus involves several methodological approaches:

    Genetic manipulation approaches:

    1. CRISPR/Cas9 gene editing:

      • Design sgRNAs targeting mogat2-b (considering L and S chromosomes)

      • Inject into fertilized eggs

      • Screen for mutations and establish knockout lines

    2. Morpholino knockdown:

      • Design antisense morpholinos targeting mogat2-b mRNA

      • Inject into early embryos

      • Verify knockdown by RT-PCR and Western blot

    Disease model applications:

    Metabolic disease models:

    • High-fat diet feeding to study hepatic steatosis

    • Analysis of lipid accumulation using Oil Red O staining

    • Glucose tolerance tests to assess insulin sensitivity

    • Lipidomic analysis of tissue samples

    Cancer models:
    Recent research has revealed that MOGAT2 can inhibit colorectal tumorigenesis by:

    • Modulating gut microbiota composition (including changes in Verrucomicrobia, Actinobacteria, and specifically Akkermansia genus)

    • Inhibiting the NF-κB signaling pathway (decreasing P65, p-P65, P50, and p-IKBα protein levels)

    Experimental readouts:

    • Colony formation assays

    • Orthotopic tumor models

    • Ki-67 immunostaining for proliferation assessment

    • Western blotting for NF-κB pathway components

    • 16S rRNA sequencing for microbiome analysis

    The dual role of mogat2 in both metabolism and tumor suppression opens intriguing research avenues, particularly as mogat2 knockout in mouse models expedites intestinal tumor growth and progression, suggesting its tumor-suppressing role in colorectal cancer .

  • What approaches can resolve discrepancies in mogat2-b activity measurements between in vitro and cellular systems?

    Discrepancies between in vitro and cellular mogat2-b activity measurements can be attributed to several factors that require specific methodological solutions:

    Common discrepancies and solutions:

    1. Substrate accessibility issues:

      • Problem: In vitro systems may not recapitulate the membrane environment

      • Solution: Include appropriate detergents (0.001% Triton X-100) or phospholipid vesicles to mimic ER membrane

      • Validation: Compare activity with microsomal preparations vs. purified protein

    2. Endogenous competing activities:

      • Problem: Cellular systems contain lipases that rapidly hydrolyze substrates and products

      • Solution: Include lipase inhibitors (MAFP) in assays

      • Validation: Measure activity with and without inhibitors

    3. Cofactor differences:

      • Problem: Cellular systems provide necessary cofactors that may be missing in vitro

      • Solution: Supplement in vitro assays with cellular extracts or cofactor mixtures

      • Validation: Systematic addition of potential cofactors to identify requirements

    4. Post-translational modifications:

      • Problem: In vitro produced protein may lack essential modifications

      • Solution: Compare E. coli-expressed protein with protein produced in eukaryotic systems

      • Validation: Western blot analysis for modification-dependent mobility shifts

    5. Substrate competition:

      • Problem: In cells, multiple lipid metabolism pathways compete for substrates

      • Solution: Use pathway-specific inhibitors to isolate mogat2-b activity

      • Validation: Measure activity with selective inhibition of competing pathways

    Research has shown that MGAT activity in human liver was historically difficult to detect until appropriate lipase inhibitors were included in assays, highlighting the importance of methodology in accurate activity determination .

  • What are the emerging techniques for studying mogat2-b protein-protein interactions and regulatory networks?

    Advanced methodologies for investigating mogat2-b interactions include:

    Protein-protein interaction techniques:

    1. Proximity labeling approaches:

      • BioID or TurboID fusion proteins expressed in Xenopus cells or embryos

      • Streptavidin pulldown of biotinylated proteins

      • Mass spectrometry identification of interaction partners

    2. Crosslinking mass spectrometry (XL-MS):

      • Chemical crosslinking of purified mogat2-b with potential partners

      • Digestion and MS/MS analysis to identify crosslinked peptides

      • Structural mapping of interaction interfaces

    3. Förster Resonance Energy Transfer (FRET):

      • Generation of fluorescently tagged mogat2-b and potential partners

      • Live-cell or in vitro measurement of protein proximity

      • High spatial resolution of interaction dynamics

    Regulatory network analysis:

    1. Single-cell transcriptomics:

      • Dissection of tissues expressing mogat2-b for single-cell sequencing

      • Identification of cell populations with coordinated expression patterns

      • Construction of gene regulatory networks

    2. ChIP-seq and ATAC-seq:

      • Identification of transcription factors regulating mogat2-b expression

      • Mapping of accessible chromatin regions around the mogat2-b locus

      • Elucidation of epigenetic regulation mechanisms

    3. Metabolomics integration:

      • Correlation of mogat2-b expression/activity with lipid metabolite profiles

      • Identification of metabolic feedback regulation

      • Multi-omics data integration for network modeling

    Emerging findings:
    Recent studies suggest that mogat2 operates within a complex regulatory network involving the NF-κB signaling pathway and interactions with the gut microbiome. For example, mogat2 has been shown to inhibit the NF-κB pathway by decreasing P65, p-P65, P50, and p-IKBα protein levels. Additionally, mogat2 deletion results in significant alterations in gut microbiota composition, which in turn promotes tumor growth in animal models . These findings highlight the importance of studying mogat2-b beyond its enzymatic function, considering its broader role in cellular signaling and host-microbiome interactions.

  • How can circular dichroism (CD) analysis be optimized for studying mogat2-b structural characteristics?

    Optimizing CD analysis for mogat2-b structural studies requires:

    Sample preparation considerations:

    1. Buffer selection:

      • Use 10 mM potassium phosphate buffer pH 7 with 50 mM Na₂SO₄

      • Avoid chloride ions that absorb in the far-UV region

      • Ensure buffer components have minimal absorbance below 260 nm

    2. Protein concentration:

      • Optimize concentration range (typically 0.1-0.5 mg/mL)

      • Perform dilution series to ensure signal linearity

      • Verify absence of aggregation (by dynamic light scattering)

    3. Detergent considerations:

      • Test protein in both aqueous solution and membrane-mimetic environments

      • Use detergents below their critical micelle concentration

      • Consider native membrane lipid extracts for physiological relevance

    Experimental protocol:

    1. Spectral acquisition:

      • Record spectra in the range 260-190 nm

      • Use 0.1 cm pathlength cuvettes

      • Average multiple scans (≥4) with buffer subtraction

      • Maintain temperature control (typically 20°C)

    2. Perturbation studies:

      • Monitor conformational changes with temperature (thermal denaturation)

      • Test structural responses to ligands/substrates

      • Examine pH-dependent structural transitions

    3. Data analysis:

      • Convert raw ellipticity to mean residue ellipticity

      • Apply deconvolution algorithms for secondary structure estimation

      • Compare experimental data with reference protein datasets

    Applications for mogat2-b:
    CD analysis has revealed that like human synucleins, Xenopus proteins are natively unfolded and can undergo conformational changes following interaction with membranes or alterations in physicochemical parameters such as temperature and pH. This conformational flexibility may influence the enzyme's tendency to aggregate and its catalytic properties. Researchers studying mogat2-b should consider these structural dynamics when interpreting enzymatic activity data .

  • What comparative genomics approaches can reveal about mogat2-b evolution and functional conservation across species?

    Comprehensive comparative genomics of mogat2-b requires:

    Sequence-based analyses:

    1. Phylogenetic tree construction:

      • Multiple sequence alignment of MGAT family proteins across vertebrates

      • Maximum likelihood or Bayesian inference methods

      • Assessment of evolutionary rates among different lineages

    2. Identification of conserved domains:

      • Motif discovery in aligned sequences

      • Mapping conserved residues to functional domains

      • Prediction of critical catalytic and regulatory sites

    3. Synteny analysis:

      • Comparison of genomic context around mogat2 genes

      • Identification of conserved gene neighborhoods

      • Detection of genome rearrangements affecting mogat2 loci

    Evolutionary insights:

    Unlike mammals that have three MGAT genes (MOGAT1, MOGAT2, and MOGAT3), Xenopus laevis has six genes (two for each isoform) due to its tetraploid condition with L and S homologous chromosomes. The genes coding for α-syn are located on chromosomes 1L (snca L) and 1S (snca S), for β-syn on chromosomes 3L (sncb L) and 3S (sncb S), and for γ-syn on chromosomes 7L (sncg L) and 7S (sncg S).

    Species-specific differences include:

    • Human MOGAT1 gene is primarily noncoding due to extensive alternative splicing

    • Mouse Mogat3 gene is a pseudogene

    • Xenopus has duplicated genes due to tetraploidy

    Functional implications:
    Comparative studies reveal that while mammalian MGAT2 is primarily expressed in intestine with limited hepatic expression, Xenopus mogat2 shows more diverse tissue expression. Research suggests that differential expression profiles may reflect species-specific adaptations in lipid metabolism pathways .

    These evolutionary differences highlight the importance of considering species-specific contexts when using Xenopus as a model for studying MGAT biology or when extrapolating findings to human health applications.

Methodology and Troubleshooting

  • What are common troubleshooting strategies for recombinant mogat2-b expression and purification?

    Researchers encountering difficulties with mogat2-b should consider:

    Expression troubleshooting:

    1. Low expression levels:

      • Optimize codon usage for E. coli

      • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express)

      • Reduce induction temperature (16-25°C)

      • Extend induction time (overnight)

    2. Inclusion body formation:

      • Reduce IPTG concentration (0.01-0.1 mM)

      • Express as fusion protein (GST, MBP)

      • Add solubility enhancers to media (sorbitol, betaine)

      • Consider refolding protocols if necessary

    3. Protein degradation:

      • Include protease inhibitors (PMSF, complete inhibitor cocktail)

      • Reduce expression time

      • Maintain samples at 4°C during processing

    Purification challenges:

    1. Poor binding to affinity resins:

      • Ensure tag is accessible (not buried in protein structure)

      • Optimize binding buffer conditions (salt, pH)

      • Check for tag cleavage during expression

    2. Co-purification of contaminants:

      • Increase washing stringency (higher salt, detergent)

      • Add secondary purification steps (ion exchange, size exclusion)

      • Consider on-column refolding for improved purity

    3. Loss of activity during purification:

      • Include stabilizing agents (glycerol, reducing agents)

      • Minimize time between purification and activity assays

      • Consider detergent addition to maintain native conformation

    Specific recommendations for mogat2-b:
    For mogat2-b purification, researchers have successfully used GSH-Sepharose for GST-fusion proteins with thrombin cleavage to remove the tag. The protocol involves capturing GST-tagged protein, on-column cleavage with thrombin, and collection of cleaved protein in the flow-through. This approach has yielded pure protein with high recovery rates .

  • How can researchers design optimized gene knockdown experiments to study mogat2-b function in Xenopus laevis?

    Effective mogat2-b knockdown experiments require:

    Experimental design considerations:

    1. Target selection:

      • Design knockdown strategies accounting for both L and S chromosomes

      • Consider developmental timing of mogat2-b expression

      • Evaluate potential off-target effects bioinformatically

    2. Knockdown methods:

      • Morpholino oligonucleotides (for embryonic studies)

      • CRISPR/Cas9 gene editing (for stable genetic models)

      • siRNA or shRNA (for cell culture experiments)

    3. Delivery approaches:

      • Microinjection (for embryos or oocytes)

      • Electroporation (for later stage embryos or tissues)

      • Lipofection (for cell culture)

    Validation protocols:

    1. Knockdown confirmation:

      • qRT-PCR for mRNA quantification (design primers specific to mogat2-b)

      • Western blot for protein detection (using validated antibodies)

      • Enzyme activity assays for functional validation

    2. Specificity controls:

      • Include mismatched/scrambled controls

      • Perform rescue experiments with knockdown-resistant constructs

      • Design multiple knockdown reagents targeting different regions

    3. Phenotypic analysis:

      • Establish dose-response relationships

      • Document developmental effects

      • Perform detailed metabolic profiling

    Analysis of lipid metabolism:

    1. Quantify glycerolipid species:

      • Measure DAG and TAG levels using TLC or LC-MS

      • Analyze fatty acid composition of glycerolipids

      • Assess flux through lipid synthesis pathways using labeled precursors

    2. Metabolic pathway analysis:

      • Investigate compensatory upregulation of alternate pathways

      • Measure expression of related enzymes (DGAT1/2, GPAT, etc.)

      • Evaluate impact on energy homeostasis and signaling

    These approaches can help establish the specific role of mogat2-b in Xenopus lipid metabolism and development, while avoiding confounding effects from related genes or nonspecific knockdown effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.