Recombinant Xenopus laevis Abhydrolase domain-containing protein 13 (abhd13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please specify it in your order for preferential consideration.
Synonyms
abhd13; Protein ABHD13; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
abhd13
Target Protein Sequence
MEKHWVLWSCAERWLLALASWSWGLCRICLLPLILTFNMYGGVILLLLIFVSIAGILFKF QDVLLYFPDQPSSSRLYIPMPTGIPHENIFIKTKDNIRLNLILLRYTGDNSSFSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLILVDYRGYGKSDGEPSEEGLYMDSEAVLDYVMTRP DIDKTKIILFGRSLGGAVAIHLASENAHRICALVLENTFLSIPHMASTLFSVLPMRYLPL WCYKNKFLSYRKIVQCRMPSLFISGLSDQLIPPFMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKELNSNHCPEANAKTSNVTII
Uniprot No.

Target Background

Database Links

KEGG: xla:432053

UniGene: Xl.76073

Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the significance of Xenopus laevis as a model for protein expression studies?

Xenopus laevis has been established as a principal vertebrate model in bioscience research for decades, offering significant advantages for protein expression and functional studies. The species demonstrates remarkable evolutionary closeness to higher vertebrates in terms of physiology, gene expression patterns, and organ development, making it particularly valuable for translational research . The ability to obtain numerous embryos throughout the year (approximately one hundred eggs per mating) facilitates large-scale experimental designs with statistical power . Additionally, the well-characterized developmental stages of X. laevis allow researchers to study protein expression across embryonic stages, larval growth, metamorphosis, and adult life with precision . For recombinant protein studies, X. laevis offers the advantage of a vertebrate expression system with post-translational modifications more similar to mammals than bacterial or insect cell alternatives.

How does the allotetraploid genome of Xenopus laevis impact protein expression studies?

The allotetraploid nature of the Xenopus laevis genome creates unique considerations for protein studies that researchers must address methodologically. X. laevis possesses 36 chromosomes (2N=36), almost double that of the related diploid frog X. tropicalis (2N=20) . Genome sequencing has confirmed that X. laevis is an allotetraploid that arose through interspecific hybridization of two diploid progenitors approximately 17-18 million years ago, followed by genome doubling . This genomic architecture results in two distinct subgenomes (designated L and S), with 56% of all genes retained in two homeologous copies . When studying specific proteins like abhd13, researchers must determine whether their target exists as single or duplicate copies and account for potential functional redundancy or specialization between homeologs. The S chromosomes are approximately 17.3% shorter in assembled sequence than their L counterparts, reflecting differential gene loss and rearrangement between the two subgenomes . This asymmetric evolution may result in different expression patterns for homeologous proteins, requiring careful experimental design to distinguish between homeologs.

What are the general characteristics of abhydrolase domain-containing proteins in amphibian models?

Abhydrolase domain-containing proteins represent a diverse superfamily of hydrolytic enzymes that share a characteristic α/β-hydrolase fold structural motif but often demonstrate varied substrate specificity and physiological functions. In vertebrates including amphibians, these proteins typically participate in lipid metabolism, cellular signaling, and detoxification pathways. While the specific functions of abhd13 in Xenopus have not been comprehensively characterized, researchers can develop hypotheses based on evolutionary conservation patterns across vertebrates. Since many essential processes at the cellular and molecular level are highly conserved across vertebrates, insights from X. laevis can potentially inform understanding of human disease mechanisms . When designing studies of recombinant abhd13, researchers should consider the potential tissue-specific expression patterns and developmental regulation that may suggest biological function.

What gene delivery systems are most effective for expressing recombinant proteins in Xenopus laevis?

The effectiveness of gene delivery systems in Xenopus laevis varies significantly depending on the target tissue, developmental stage, and experimental goals. For recombinant protein expression, researchers have explored several approaches with varying success rates:

Delivery MethodEffectiveness in X. laevisOptimal ApplicationSuccess Rate
Electroporation (Tadpoles)HighEmbryonic/larval stages100% for tadpoles
Electroporation (Adults)Low for neurons, moderate for glial cellsAdult glial cells50% for adults in vivo
AAV VectorsVery low for neuronsNot recommended4% success rate
Lentiviral VectorsNot effectiveNot recommended0% success
VSV VectorsHighAdult neurons90% success rate

For recombinant abhd13 expression, VSV (vesicular stomatitis virus) vectors have shown robust transgene delivery in adult X. laevis neurons within 2-5 days post-infection . Specifically, glycoprotein gene-deleted rVSVΔG(VSV-G) with inserted transgenes demonstrated expression in 9 out of 10 animals when injected into the olfactory bulb, telencephalon, and optic tectum . This approach allows for acute, targeted expression of recombinant proteins without requiring germline modification. For embryonic studies, direct microinjection of mRNA or plasmid DNA into early embryos remains the standard approach for transient expression of recombinant proteins.

How can researchers optimize purification of recombinant Xenopus laevis proteins?

Purification of recombinant proteins from Xenopus laevis requires careful consideration of the expression system and protein characteristics. While many researchers utilize heterologous expression systems (bacterial, insect, or mammalian cells) for producing Xenopus proteins, X. laevis oocytes and embryos can serve as effective expression systems themselves, particularly for proteins requiring specific post-translational modifications or interaction partners found in amphibian cells.

For recombinant abhd13 purification, researchers should consider:

  • Expression system selection based on requirements for post-translational modifications

  • Optimization of solubility through fusion tags (His, GST, MBP) and buffer conditions

  • Development of purification protocols that maintain enzymatic activity

  • Validation of protein folding and function through activity assays

When designing purification strategies, the hydrophobicity profile and potential membrane association of abhd13 should guide detergent selection and solubilization approaches. Additionally, researchers should validate purified proteins through activity assays specific to abhydrolase enzymes to ensure native conformation is maintained.

What approaches are recommended for CRISPR/Cas9-mediated gene editing of abhd13 in Xenopus laevis?

The allotetraploid genome of Xenopus laevis introduces unique challenges for gene editing that must be addressed methodologically. When targeting abhd13 using CRISPR/Cas9, researchers must account for potential homeologous copies resulting from the genome duplication event that occurred approximately 17-18 million years ago .

A recommended workflow for CRISPR/Cas9-mediated editing of abhd13 includes:

  • Identify and sequence both L and S homeologs of the abhd13 gene, if present

  • Design guide RNAs targeting conserved regions for simultaneous editing of both homeologs, or specific regions for selective targeting

  • Deliver CRISPR/Cas9 components via microinjection into fertilized eggs

  • Validate editing efficiency through sequencing and assess potential off-target effects

  • Establish genotyping protocols to identify successful editing in F0 and subsequent generations

The asymmetric evolution of the two subgenomes in X. laevis may result in different regulatory landscapes for each homeolog, which must be considered when interpreting phenotypes resulting from gene editing experiments. When targeting only one homeolog, researchers should assess potential compensation by the remaining copy.

How can abhd13 function be assessed through loss-of-function studies in Xenopus embryos?

Loss-of-function studies for abhd13 in Xenopus laevis embryos can be approached through several complementary methods, each with specific advantages:

ApproachTemporal ControlSpecificityAdvantagesLimitations
MorpholinosImmediateMedium-HighEasy delivery, dose-controlTemporary effect, off-targets
CRISPR/Cas9PermanentHighComplete knockoutMosaicism in F0, homeolog redundancy
Dominant negativesImmediateMediumCan target specific domainsMay affect related proteins
Small molecule inhibitorsAdjustableVariableReversible, timing controlSpecificity depends on compound

For morpholino-based approaches, researchers typically inject 1-10 ng of translation-blocking or splice-blocking oligonucleotides at the 1-2 cell stage. When interpreting phenotypes, it is essential to validate specificity through rescue experiments with co-injection of morpholino-resistant mRNA encoding the wild-type protein. Given X. laevis' well-documented regenerative capacity, especially at tadpole stages , abhd13 functional studies could provide insight into its potential role in tissue regeneration by examining loss-of-function effects on regenerative processes.

What methods are most effective for analyzing abhd13 expression patterns across tissues and developmental stages?

Understanding the spatial and temporal expression patterns of abhd13 is crucial for interpreting its biological functions. Multiple complementary approaches can be employed:

  • RNA-seq analysis across developmental stages and tissues

    • Leverage existing datasets from Xenbase and published literature

    • Generate custom transcriptome data from specific tissues of interest

    • Compare expression between L and S homeologs if both exist

  • Quantitative RT-PCR for sensitive detection

    • Design primers specific to abhd13, carefully distinguishing between homeologs

    • Normalize to multiple reference genes validated for stability across conditions

    • Analyze using the ΔΔCt method with appropriate statistical analysis

  • In situ hybridization for spatial localization

    • Design riboprobes specific to abhd13 mRNA

    • Optimize fixation conditions based on embryonic stage

    • Consider double fluorescent in situ hybridization to co-localize with potential interaction partners

  • Immunohistochemistry for protein localization

    • Validate antibody specificity using knockout controls

    • Optimize fixation protocols to preserve epitope accessibility

    • Combine with markers for subcellular compartments to determine precise localization

X. laevis offers the advantage of a well-characterized developmental timeline, allowing for precise staging of samples and correlation of expression patterns with developmental events. The availability of extracts from various tissues and developmental stages makes this model particularly valuable for understanding dynamic changes in abhd13 expression.

How can researchers investigate potential protein-protein interactions involving abhd13?

Identifying interaction partners of abhd13 can provide crucial insights into its biological functions and regulatory mechanisms. Several approaches are particularly well-suited for Xenopus laevis:

  • Co-immunoprecipitation followed by mass spectrometry

    • Express tagged versions of abhd13 in embryos or oocytes

    • Validate interactions through reciprocal pull-downs

    • Compare interactomes across developmental stages or tissues

  • Proximity labeling approaches

    • Fuse abhd13 to BioID or TurboID for proximity-dependent biotinylation

    • Express in embryos via microinjection of mRNA

    • Isolate biotinylated proteins and identify by mass spectrometry

  • Yeast two-hybrid screening

    • Use abhd13 as bait against a Xenopus cDNA library

    • Validate positive hits in Xenopus embryos or oocytes

    • Consider domain-specific constructs to map interaction regions

  • Bimolecular Fluorescence Complementation (BiFC)

    • Fuse abhd13 and candidate partners to complementary fragments of fluorescent proteins

    • Express in embryos or oocytes to visualize interactions in vivo

    • Combine with subcellular markers to determine interaction localization

The evolutionary conservation between Xenopus and mammals means that interactions identified in X. laevis often have relevance to mammalian systems . When designing interaction studies, researchers should consider the potential impact of the allotetraploid genome on protein interaction networks, as homeologous proteins may have diverged in their interaction specificities.

How does the allotetraploid genome of Xenopus laevis affect functional redundancy of abhd13?

The allotetraploid nature of the Xenopus laevis genome creates unique considerations for functional studies of proteins like abhd13. Following whole genome duplication approximately 17-18 million years ago, 56% of genes have been retained as homeologous pairs , with differing rates of gene loss between the L and S subgenomes. This genomic architecture raises several important considerations:

  • Subgenome-specific retention and expression

    • The L subgenome has generally preserved more ancestral genes than the S subgenome

    • Expression levels often differ between homeologs, with the L copy typically showing higher expression

    • When studying abhd13, researchers should determine if both homeologs exist and their relative expression levels

  • Functional divergence between homeologs

    • Homeologous proteins may have undergone subfunctionalization (division of ancestral functions)

    • Neofunctionalization (acquisition of novel functions) may also occur in one copy

    • Single knockout phenotypes may be subtle due to compensation by the remaining homeolog

  • Experimental approaches to address redundancy

    • Design targeting strategies that can simultaneously inactivate both homeologs

    • Consider graded approaches that manipulate each homeolog independently and in combination

    • Analyze expression correlation patterns to identify potential compensatory mechanisms

The asymmetric evolution observed between the L and S subgenomes suggests that homeologous abhd13 proteins, if both are retained, may have evolved different regulatory mechanisms or even functions, requiring careful experimental design to fully elucidate their roles.

What are the considerations for designing structure-function studies of recombinant abhd13?

Structure-function analysis of abhd13 requires careful experimental design that accounts for the catalytic mechanism of abhydrolase domain-containing proteins while allowing for targeted manipulation of specific structural features. Key considerations include:

  • Domain identification and mutagenesis

    • Identify conserved catalytic residues in the abhydrolase domain through sequence alignment

    • Design point mutations that specifically disrupt catalytic function without affecting folding

    • Create domain deletion constructs to assess the function of non-catalytic regions

  • Expression system selection

    • Consider the requirements for post-translational modifications

    • Evaluate the need for specific chaperones or cofactors for proper folding

    • Assess the impact of expression temperature and conditions on protein solubility

  • Activity assays

    • Develop or adapt enzymatic assays specific to the predicted function of abhd13

    • Include positive controls with known activity and negative controls with catalytic mutations

    • Optimize assay conditions (pH, temperature, cofactors) for Xenopus proteins

  • Structural biology approaches

    • Consider X-ray crystallography or cryo-EM for high-resolution structural determination

    • Use homology modeling based on related proteins if experimental structures are unavailable

    • Validate structural predictions through targeted mutagenesis and functional assays

The evolutionary relationship between X. laevis and higher vertebrates makes structure-function insights potentially applicable to understanding the role of abhd13 orthologs in human biology and disease .

What are emerging technologies that may advance research on abhd13 in Xenopus laevis?

Several cutting-edge approaches show particular promise for advancing research on abhd13 in Xenopus laevis:

  • Single-cell transcriptomics to reveal cell-type specific expression patterns

  • Optical control of protein function using optogenetic approaches

  • Base editing or prime editing for precise modification of specific residues

  • Tissue-specific and inducible CRISPR systems for spatiotemporal control of gene editing

  • Proteomics approaches to identify post-translational modifications and interaction networks

The continued refinement of gene delivery methods, particularly viral vectors like VSV that have shown high efficiency in Xenopus neurons , will enable more sophisticated functional studies. Additionally, the ongoing characterization of the allotetraploid genome provides an increasingly detailed foundation for genomic and transcriptomic analyses.

How can findings from abhd13 studies in Xenopus laevis be translated to mammalian systems?

The evolutionary conservation between Xenopus laevis and mammals creates valuable opportunities for translational research. When extending findings from X. laevis abhd13 studies to mammalian systems, researchers should consider:

  • Comparative genomics to identify conserved regulatory elements and protein domains

  • Validation of key findings in mammalian cell culture models and model organisms

  • Assessment of expression patterns in corresponding tissues/developmental stages

  • Identification of disease-associated variants in human orthologs informed by functional domains characterized in X. laevis

The remarkable regenerative capacity of X. laevis tissues, particularly at tadpole stages , may provide unique insights into potential regenerative functions of abhd13 that could inform therapeutic approaches in mammals. Additionally, the striking parallels between tumor pathogenesis and Xenopus early embryo development pathways suggest that abhd13 studies in this model could have implications for understanding its potential role in cancer biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.