Recombinant Xenopus laevis Acetylcholine receptor subunit epsilon (chrne)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type requirement. We will prioritize developing the specified tag if possible.
Synonyms
chrne; Acetylcholine receptor subunit epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-504
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
chrne
Target Protein Sequence
SESEESRLIKHLFTSYDQKARPSKGLDDVVPVTLKLTLTNLIDLNEKEETLTTNVWVQIA WNDDRLVWNVTDYGGIGFVPVPHDIMWLPDIVLENNIDGNFEVAYYANVLVYNTGYIYWL PPAIFRSTCNIEITYFPFDWQNCSLVFRSKTYSANEIDLQLVTDDETGLPFDQVDIDREA FTENGEWAIMHRPARKILNPKYSKEDLRYQEIVFNLIIQRKPLFYIINIIVPCVLISFLV VLVYFLPAKAGGQKCTVSISVLLAQTVFLFLIAQMVPETSLSVPLIGKYLMFVMFVSTLI VLSCVIVLNVSLRSPSTHNLSTKVKHMLLEVLPQFLHLRVEPCDEGEETPRERRRSSLGI MLKAEEYVLKKPRSELMFERQRERHGMRREPDGYRADGFDVGVTTTLYRNLAQCAPEIKD CVDACNFITQNTKEQNRTGSEMENWILIGKVLDVLCFWVALPLFVLGTLAIFLMGHFNTA PEHPF
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change leads to the opening of an ion-conducting channel across the plasma membrane.
Database Links

KEGG: xla:386670

UniGene: Xl.1024

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Epsilon/CHRNE sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the Xenopus laevis Acetylcholine Receptor Subunit Epsilon (chrne) and why is it important in research?

The Acetylcholine Receptor Subunit Epsilon (chrne) is a critical component of the nicotinic acetylcholine receptor complex in adult muscle cells. This subunit is particularly significant because it replaces the gamma subunit during the developmental transition from embryonic to adult muscle fiber types. Research shows that this subunit substitution substantially alters receptor function, particularly regarding ion permeability and channel kinetics . The Xenopus laevis model offers an excellent platform to study these receptors because of the abundant availability of embryos, their rapid development, and the ability to perform both in vivo and in vitro manipulations .

How does the chrne subunit differ functionally from the gamma subunit in acetylcholine receptors?

The transition from gamma to epsilon subunit represents a critical developmental shift in acetylcholine receptor function. Research demonstrates that this subunit replacement significantly alters calcium permeability. When expressed in Xenopus laevis oocytes, adult-type receptors (alpha beta delta epsilon) show approximately a 3-fold increase in the PCa²⁺/PNa⁺ permeability ratio compared to embryonic-type receptors (alpha beta gamma delta). This permeability change extends to other divalent cations including Ba²⁺ and Sr²⁺ .

The functional significance of this alteration is reflected in calcium flux measurements, where the contribution of Ca²⁺ current to the total inward current increases from 0.8% in gamma-containing receptors to 2.5% in epsilon-containing receptors. This developmental regulation of calcium influx likely plays an important role in muscle maturation and neuromuscular junction stabilization .

What is the optimal protocol for reconstituting lyophilized recombinant Xenopus laevis chrne protein?

For optimal reconstitution of lyophilized recombinant Xenopus laevis chrne protein, follow this methodology:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this may compromise protein integrity

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can Xenopus laevis oocytes be used to study chrne function in electrophysiological experiments?

Xenopus laevis oocytes provide an excellent heterologous expression system for studying acetylcholine receptor function. A methodological approach includes:

  • Oocyte Preparation:

    • Harvest stage V-VI oocytes from adult female Xenopus laevis

    • Defolliculate oocytes using collagenase treatment (typically 2 mg/mL in calcium-free OR2 solution)

    • Maintain oocytes in modified Barth's solution at 18°C

  • cRNA Injection:

    • Prepare cRNA for all receptor subunits (alpha, beta, delta, and epsilon)

    • Inject 2-10 ng of each subunit cRNA in a 1:1:1:1 ratio

    • Allow 2-5 days for protein expression

  • Electrophysiological Recording:

    • Use two-electrode voltage clamp to measure acetylcholine-induced currents

    • Analyze current-voltage relationships in various ionic conditions

    • Calculate permeability ratios using the Goldman-Hodgkin-Katz equation

This approach has successfully revealed that epsilon-containing receptors have distinct ion permeability characteristics compared to gamma-containing receptors, particularly with respect to divalent cations like Ca²⁺ .

What considerations are important when using recombinant chrne protein for antibody production and validation?

When generating and validating antibodies against recombinant Xenopus laevis chrne protein:

  • Antigen Selection:

    • Use full-length protein (amino acids 20-504) for polyclonal antibody production

    • For monoclonal antibodies, select unique epitopes that are not conserved in gamma subunits

    • Consider using peptide fragments from extracellular domains for higher specificity

  • Production Strategy:

    • Ensure high purity of immunogen (>90% by SDS-PAGE)

    • Monitor antibody specificity through ELISA against both recombinant protein and peptides

    • Test cross-reactivity with gamma subunit and other acetylcholine receptor subunits

  • Validation Protocol:

    • Perform Western blotting on tissue samples from different developmental stages

    • Confirm specificity through immunoprecipitation of native receptors

    • Validate with immunohistochemistry on both tadpole and adult Xenopus muscle tissues

    • Include negative controls using pre-immune serum and absorption controls

  • Storage and Handling:

    • Aliquot antibodies to avoid freeze-thaw cycles

    • Store at -20°C with appropriate preservatives

    • Test activity periodically against standard samples

How can recombinant Xenopus laevis chrne be used to study developmental changes in neuromuscular junction formation?

The developmental transition from gamma to epsilon subunit expression represents a critical event in neuromuscular junction maturation. Researchers can leverage recombinant Xenopus laevis chrne in several sophisticated experimental approaches:

  • Xenopus Neural Crest-Muscle Co-culture System:

    • Dissect neural crest from Xenopus embryos following established protocols

    • Culture with developing muscle cells in defined media

    • Introduce recombinant chrne protein or manipulate endogenous expression

    • Monitor changes in synaptic structure and function using electrophysiology and imaging

  • Subunit-specific Knockdown/Replacement Studies:

    • Design morpholinos or CRISPR guides targeting endogenous chrne

    • Rescue with recombinant chrne or mutant variants

    • Analyze effects on receptor clustering, synaptic transmission, and calcium signaling

  • Calcium Imaging Analysis:

    • Express genetically encoded calcium indicators in muscle cells

    • Compare calcium dynamics between gamma-containing and epsilon-containing synapses

    • Quantify spatiotemporal aspects of calcium signaling during development

This research approach can reveal how the 3-fold increase in calcium permeability associated with epsilon subunit incorporation affects synapse stabilization and muscle maturation .

What are the key considerations when designing mutations in the Xenopus laevis chrne protein for structure-function studies?

Structure-function analysis of chrne requires strategic mutation design based on sequence conservation, structural models, and functional domains:

  • Target Selection Strategy:

    • Focus on residues that differ between gamma and epsilon subunits to identify determinants of unique functional properties

    • Prioritize the transmembrane domains that contribute to ion selectivity and permeation

    • Consider conserved residues in the ligand-binding domain that might modulate gating kinetics

  • Mutation Design Matrix:

DomainTarget ResiduesMutation TypeExpected EffectAnalysis Method
M2 pore liningNegatively charged residuesCharge neutralization or reversalAltered calcium permeabilityReversal potential measurements
Ligand bindingAromatic residuesConservative substitutionsModified agonist affinityDose-response curves
Intracellular loopPhosphorylation sitesPhosphomimetic (S/T to D/E)Changed desensitization kineticsPatch-clamp recordings
Extracellular domainN-glycosylation sitesN to Q substitutionsAffected receptor assemblyWestern blot analysis
  • Quality Control Procedures:

    • Verify expression levels of mutant proteins to ensure comparable surface expression

    • Confirm proper folding through binding assays with alpha-bungarotoxin

    • Assess pentameric assembly using sucrose gradient centrifugation

How does the calcium permeability of epsilon-containing acetylcholine receptors influence cellular signaling in Xenopus muscle?

The enhanced calcium permeability of adult-type acetylcholine receptors containing the epsilon subunit has significant implications for muscle cell signaling and development:

  • Calcium-Dependent Signaling Pathways:

    • The 3-fold increase in calcium permeability (PCa²⁺/PNa⁺) in epsilon-containing receptors substantially alters the contribution of calcium current to total inward current (from 0.8% to 2.5%)

    • This enhanced calcium entry can activate calcium-dependent kinases (CaMKII, PKC)

    • Downstream effects include altered gene expression through CREB and other transcription factors

  • Synapse Maturation Mechanisms:

    • Calcium-dependent activation of proteases may contribute to synaptic remodeling

    • Local calcium transients can regulate receptor clustering through interactions with rapsyn and MuSK

    • Calcium entry through acetylcholine receptors may regulate local protein synthesis at the synapse

  • Experimental Approaches to Investigate Calcium Signaling:

    • Express gamma and epsilon-containing receptors in parallel muscle cell cultures

    • Apply quantitative calcium imaging using ratiometric indicators

    • Employ pharmacological inhibitors of calcium-dependent pathways

    • Measure activation of downstream signaling molecules through phospho-specific antibodies

These investigations can help determine how the developmental regulation of calcium influx contributes to the transition from polyneuronal to mononeuronal innervation during neuromuscular junction maturation .

What are common challenges when working with recombinant Xenopus laevis chrne protein and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Xenopus laevis chrne protein:

  • Protein Solubility Issues:

    • Problem: Aggregation after reconstitution

    • Solution: Add mild detergents (0.1% Triton X-100) or adjust buffer ionic strength

    • Protocol Modification: Reconstitute at lower concentration (0.1 mg/mL) and gradually dilute

  • Stability Concerns:

    • Problem: Activity loss during storage

    • Solution: Add glycerol to 50% final concentration and store aliquots at -80°C

    • Best Practice: Avoid repeated freeze-thaw cycles and maintain reconstituted protein at 4°C for short-term use

  • Expression System Limitations:

    • Problem: Proper folding in E. coli

    • Solution: Consider alternative expression systems such as insect cells for complex multi-domain proteins

    • Quality Control: Verify structural integrity through circular dichroism or limited proteolysis

  • Functional Assessment Challenges:

    • Problem: Difficulty confirming biological activity

    • Solution: Develop binding assays with alpha-bungarotoxin or specific antibodies

    • Validation Approach: Compare with native protein isolated from Xenopus muscle tissue

How can researchers optimize experimental conditions when studying calcium flux through epsilon-containing acetylcholine receptors?

Optimizing calcium flux measurements requires careful attention to several experimental parameters:

  • Solution Composition Optimization:

    • Calcium Concentration: Test multiple concentrations (0.5-10 mM) to establish dose-response relationships

    • Competing Ions: Systematically vary Na⁺ and other divalent cation concentrations

    • pH Control: Maintain consistent pH (7.4) across all solutions to avoid confounding effects

  • Recording Parameter Matrix:

ParameterRecommended RangeOptimization StrategyImpact on Measurement
Holding Potential-100 to +50 mV10 mV incrementsAffects driving force for calcium entry
Agonist Concentration1-100 μM AChLog-scale incrementsInfluences channel open probability
Calcium IndicatorFura-2, Fluo-4Compare multiple indicatorsDetermines signal-to-noise ratio
Temperature18-25°CControl within ±1°CAffects channel kinetics
  • Signal Detection Enhancement:

    • Use calcium-free solutions for baseline recordings

    • Apply rapid solution exchange systems (<1 ms switching time)

    • Consider patch-clamp fluorometry for simultaneous electrical and optical measurements

    • Employ calcium chelators (BAPTA, EGTA) with different kinetics to dissect temporal aspects of calcium signaling

These optimizations will help researchers accurately quantify the 3-fold difference in calcium permeability between gamma and epsilon-containing receptors .

How might advanced imaging techniques enhance our understanding of chrne dynamics during Xenopus development?

Advanced imaging technologies offer new opportunities to investigate chrne dynamics during development:

  • Micro-CT Imaging Applications:

    • Recent advances in micro-CT imaging of Xenopus laevis development provide unprecedented 3D visualization of morphological changes during metamorphosis

    • This technology could be adapted to track neuromuscular junction remodeling during the gamma-to-epsilon subunit transition

    • Integration with contrast agents specific for acetylcholine receptors would enable longitudinal studies of receptor distribution

  • Super-Resolution Microscopy Approaches:

    • STORM or PALM microscopy can resolve individual receptor clusters at 20-30 nm resolution

    • Track changes in receptor density and organization during development

    • Combine with multi-color labeling to visualize relationships between receptor subtypes and scaffolding proteins

  • Live Imaging Strategies:

    • Generate transgenic Xenopus lines expressing fluorescently tagged chrne

    • Perform time-lapse imaging during metamorphosis to track receptor turnover

    • Implement FRET-based sensors to monitor conformational changes during channel activation

These imaging approaches would complement electrophysiological studies of calcium permeability by providing spatial context to functional changes during development.

What are the implications of chrne research for understanding human neuromuscular disorders?

Research on Xenopus laevis chrne has significant translational potential for human neuromuscular disorders:

  • Congenital Myasthenic Syndromes (CMS):

    • Mutations in the human CHRNE gene account for approximately 30-60% of all CMS cases

    • Xenopus models can provide insights into pathophysiological mechanisms

    • Specific mutations can be recapitulated in recombinant Xenopus chrne for functional studies

  • Therapeutic Development Opportunities:

    • The 3-fold difference in calcium permeability between gamma and epsilon subunits suggests potential therapeutic strategies

    • Compounds that modulate calcium flux through acetylcholine receptors could compensate for receptor deficiencies

    • Gene therapy approaches targeting chrne expression could be tested in Xenopus models

  • Comparative Analysis Framework:

AspectXenopus laevisHumanResearch Implications
Subunit SwitchGamma to Epsilon during metamorphosisGamma to Epsilon in late fetal developmentModel for developmental regulation
Calcium Permeability3-fold increase with epsilonSimilar increase observedConserved functional significance
Receptor KineticsFaster decay with epsilonComparable kinetic changesPotential drug targets
Disease MutationsCan be engineeredOver 100 known pathogenic variantsPlatform for personalized medicine

By leveraging the experimental advantages of Xenopus laevis, researchers can develop and test interventions that may ultimately benefit patients with neuromuscular junction disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.