Recombinant Xenopus laevis Apoptosis regulator R11

Shipped with Ice Packs
In Stock

Description

Functional Role in Apoptosis and Ubiquitination

XR11 regulates apoptosis by interfering with the assembly of K11-linked ubiquitin chains, which are critical for substrate recognition by the Anaphase-Promoting Complex/Cyclosome (APC/C). Key findings include:

  • Inhibition of K11 Chains: XR11 disrupts APC/C-dependent degradation of substrates like securin and cyclin B1 by preventing the formation of K11-linked ubiquitin chains, which act as proteasomal targeting signals .

  • Developmental Impact: Injection of XR11 into Xenopus tropicalis embryos delays cell division and causes embryonic lethality before gastrulation, mimicking phenotypes seen with dominant-negative UbcH10 mutants .

  • Caspase Activation: XR11’s activity intersects with caspase-3/7 pathways, as shown by reduced apoptotic trigger wave speeds in cytosolic extracts treated with caspase inhibitors .

In Vitro Studies

  • Ubiquitination Assays: XR11 impedes APC/CCdh1 and UbcH10-mediated assembly of K11-linked chains, stabilizing substrates such as geminin and Plk1 in human cell lysates .

  • Proteasome Interaction: Substrates modified with XR11-generated chains show reduced affinity for proteasomal receptors (e.g., Rad23), impairing degradation efficiency .

In Vivo Studies

  • Embryonic Development: Xenopus embryos injected with XR11 exhibit developmental arrest, underscoring its role in cell-cycle progression .

  • Tissue Regeneration: Apoptosis mediated by XR11-like regulators is essential for tail regeneration in Xenopus larvae, with caspase-3 activation observed in regeneration buds .

Comparative Insights

  • Evolutionary Conservation: XR11’s mechanism shares similarities with mammalian apoptosis regulators, such as PNAS-4, though structural differences exist .

  • Trigger Waves: Apoptotic signals propagate via trigger waves (~30 µm/min) in Xenopus extracts, a process slowed by XR11 or caspase inhibitors .

Applications in Research

  • Cell-Cycle Studies: Used to dissect APC/C-dependent ubiquitination in mitosis and meiosis .

  • Regeneration Models: Facilitates analysis of apoptosis during tissue repair in Xenopus tails .

  • Optogenetic Tools: Complementary to techniques like KillerRed-induced apoptosis for spatial-temporal control of cell death .

Key Challenges and Future Directions

  • Specificity: XR11’s effects on non-APC/C pathways (e.g., SCF complexes) require further elucidation .

  • Therapeutic Potential: Insights into K11-linked ubiquitination could inform strategies for cancer or degenerative diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Apoptosis regulator R11; XR11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Protein Sequence
MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQ ALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGR ALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQE RFGRLLTIVMLTGVFALVCYMRRR
Uniprot No.

Target Background

Function
Provides robust protection against cell death.
Database Links

UniGene: Xl.48468

Protein Families
Bcl-2 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Xenopus laevis Apoptosis regulator R11 and what cellular functions does it regulate?

Xenopus laevis Apoptosis regulator R11 (XR11) is a 204-amino acid protein involved in the regulation of programmed cell death pathways in the African clawed frog. This protein participates in the complex molecular cascade that controls cellular apoptosis, which is critical during both development and tissue homeostasis. The protein sequence (MEGSSRDLVEKFVSKKLSQNEACRKFSNNPNPMPYLMEPSTSERPGEGATQGIVEEEVLQALLEATEEFELRYQRAFSDLTSQLHITQDTAQQSFQQVMGELFRDGTNWGRIVAFFSFGRALCVESANKEMTDLLPRIVQWMVNYLEHTLQPWMQENGGWEAFVGLYGKNAAAQSRESQERFGRLLTIVMLTGVFALVCYMRRR) reveals structural domains consistent with apoptotic regulation functionality . Unlike mammalian systems where apoptosis pathways are extensively characterized, amphibian apoptosis regulation presents unique evolutionary adaptations that make XR11 valuable for comparative studies of programmed cell death mechanisms across vertebrate lineages.

How should researchers properly handle and reconstitute Recombinant Xenopus laevis Apoptosis regulator R11?

Proper handling of Recombinant XR11 requires strict adherence to specific protocols to maintain protein integrity. The recombinant protein typically comes as a lyophilized powder and should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term stability, researchers should:

  • Briefly centrifuge the vial before opening to ensure all content is at the bottom

  • Add glycerol to a final concentration of 5-50% (optimally 50%) after reconstitution

  • Aliquot the solution to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Keep long-term storage aliquots at -20°C/-80°C

The protein will remain stable in Tris/PBS-based buffer (pH 8.0) with 6% trehalose . Repeated freeze-thaw cycles significantly compromise protein activity and should be strictly avoided to preserve the functional integrity of the recombinant protein.

What expression systems are most effective for producing Recombinant Xenopus laevis Apoptosis regulator R11?

Recombinant XR11 is most commonly produced using prokaryotic expression systems, particularly E. coli . This approach offers several methodological advantages:

Expression SystemAdvantagesDisadvantagesTypical YieldPurity
E. coliCost-effective, rapid production, established protocols, scalableLimited post-translational modifications, potential inclusion body formationHigh (mg/L culture)>90% after purification
Insect cellsMore complex eukaryotic modifications, better foldingHigher cost, longer production timeModerateHigh
Mammalian cellsMost authentic post-translational modificationsHighest cost, complex culture conditionsLowerVariable

For the His-tagged full-length Xenopus laevis Apoptosis regulator R11, E. coli expression followed by immobilized metal affinity chromatography (IMAC) purification achieves purity levels exceeding 90% as determined by SDS-PAGE analysis . When selecting an expression system, researchers should consider whether post-translational modifications are critical for their specific experimental applications, as E. coli systems may not replicate all modifications present in the native Xenopus protein.

How does Xenopus laevis Apoptosis regulator R11 compare functionally to mammalian apoptosis regulators in experimental models?

Comparative analysis between Xenopus laevis and mammalian apoptosis regulation reveals both conserved mechanisms and species-specific differences. In thymoma cell line studies comparing Xenopus B3/B7 and mouse EL4 lines, researchers have identified differential localization patterns of key apoptotic proteins including p53 and Mdm2 . These differences provide insights into the evolutionary conservation of apoptotic machinery.

Functionally, Xenopus apoptotic pathways show distinct characteristics that potentially contribute to amphibian-specific phenomena such as enhanced cancer resistance and regenerative capabilities . When designing comparative experiments, researchers should consider:

  • Using matched cell types (e.g., thymocytes or thymoma lines) from both species

  • Employing identical apoptotic stimuli at equipotent concentrations

  • Measuring apoptosis using multiple complementary assays (morphological, biochemical, and molecular)

  • Accounting for temperature differences in optimal physiological conditions

  • Analyzing both intrinsic and extrinsic apoptotic pathways

These comparative approaches have revealed that while core apoptotic machinery is conserved across vertebrates, regulatory mechanisms involving proteins like XR11 may contribute to species-specific responses to cellular stress and damage.

What role does mitochondrial signaling play in Xenopus laevis apoptosis pathways involving R11?

Mitochondria serve as crucial regulatory hubs in Xenopus laevis apoptotic pathways. Unlike the relatively simple apoptotic system in C. elegans, Xenopus demonstrates a complex mitochondrial involvement similar to mammals . Research has established that:

  • Apoptotic changes in Xenopus laevis oocyte extracts require the presence of mitochondria-enriched membrane fractions

  • The Bcl-2 protein localizes to mitochondrial membranes in Xenopus cells, indicating evolutionary conservation of this apoptotic checkpoint

  • Mitochondrial proteins can directly activate cellular apoptotic programs in Xenopus systems

When studying R11's interaction with mitochondrial pathways, researchers should employ subcellular fractionation techniques to isolate intact mitochondria from Xenopus tissues. Experiments tracking the translocation of apoptotic factors between cytosolic and mitochondrial compartments during apoptosis induction provide valuable insights into the role of R11 in regulating the intrinsic apoptotic pathway. Mitochondrial membrane potential measurements using fluorescent probes such as JC-1 or TMRE can quantify mitochondrial outer membrane permeabilization (MOMP) events that may be regulated by R11.

How can optogenetic approaches be integrated with Apoptosis regulator R11 studies in Xenopus laevis?

Optogenetic tools offer unprecedented temporal and spatial control over apoptosis induction in Xenopus models. KillerRed (KR), a fluorescent protein that generates reactive oxygen species (ROS) when exposed to green light, has been successfully used to trigger apoptosis in specific Xenopus tissues . This approach can be integrated with R11 studies through several methodological strategies:

  • Co-expression of KillerRed and tagged R11 to observe real-time localization changes of R11 during optogenetically-induced apoptosis

  • Using membrane-bound KillerRed introduced through mRNA microinjection into Xenopus embryos to study tissue-specific apoptotic responses

  • Creating light-exposure gradients to analyze R11 activity across differentially stressed cellular populations

  • Combining optogenetic activation with time-lapse microscopy to track R11 dynamics during apoptosis progression

Researchers have demonstrated that KillerRed activation in Xenopus tissues results in significant increases in active Caspase-3 expression within 1-5 hours post-exposure, confirming apoptosis induction . This system proves particularly valuable for regeneration studies in Xenopus, where apoptosis plays a key role in repair processes. The ability to induce apoptosis with high spatial and temporal specificity while minimizing non-specific damage makes optogenetic approaches ideal for investigating R11's function in normal development and regenerative contexts.

What methodological approaches are most effective for studying R11 interactions with RAS signaling pathways in Xenopus models?

Investigating R11 interactions with RAS signaling pathways in Xenopus requires specialized techniques that preserve protein-protein interactions. Based on RAS-targeting approaches developed for other systems, researchers can adapt several methodologies:

  • Single-chain variable fragment (scFv) expression: The scFv Y13-259 has successfully inhibited insulin-stimulated meiosis in Xenopus laevis oocytes by targeting RAS . Similar approaches could be employed to study R11-RAS interactions by developing specific R11-targeting scFvs.

  • Pull-down assays with activated vs. inactive RAS: Using immobilized GTP-bound (active) and GDP-bound (inactive) RAS proteins to identify differential binding of R11 during various stages of Xenopus development.

  • Proximity-based labeling: BioID or APEX2 fusions with R11 can identify proximal protein interactions in living Xenopus cells, potentially revealing transient interactions with RAS pathway components.

When designing experiments to study these interactions, researchers should account for the developmentally regulated nature of both apoptosis and RAS signaling. Studies in Xenopus embryos at different developmental stages can reveal stage-specific interactions between R11 and RAS pathways.

What are the most common technical challenges in experiments using Recombinant Xenopus laevis Apoptosis regulator R11 and how can they be addressed?

Researchers working with Recombinant XR11 encounter several technical challenges that require methodological solutions:

ChallengeUnderlying CauseSolution
Protein aggregationImproper reconstitution, storage, or buffer compositionUse freshly prepared protein, optimize buffer conditions (pH 8.0), include 6% trehalose as stabilizer
Loss of activity after storageRepeated freeze-thaw cyclesAliquot reconstituted protein with 50% glycerol and store at -80°C
Inconsistent results between batchesVariation in expression and purificationCharacterize each batch for purity (>90% by SDS-PAGE) and activity before use
Non-specific interactionsHigh concentration or improper experimental designInclude appropriate controls, optimize protein concentration, use tagged versions for specific detection
Temperature sensitivityXenopus proteins evolved at lower temperaturesConduct experiments at physiologically relevant temperatures (18-23°C for Xenopus systems)

When troubleshooting unexpected results, researchers should systematically evaluate protein quality, experimental conditions, and the biological context of the Xenopus system. Comparative analyses with mammalian orthologs can provide valuable internal controls to distinguish between technical issues and genuine biological differences.

How is Recombinant Xenopus laevis Apoptosis regulator R11 utilized in regeneration and repair studies?

Xenopus laevis serves as an excellent model organism for regeneration studies due to its remarkable ability to repair and regenerate various tissues and organs . The apoptotic process, potentially involving R11, plays a crucial role in these regenerative phenomena. Methodological approaches to utilize R11 in regeneration research include:

  • Targeted tissue ablation models: Using optogenetic tools like KillerRed to induce apoptosis in specific tissues (eye, pronephric kidney) followed by monitoring R11 expression during regeneration

  • Protein replacement studies: Depleting endogenous R11 through morpholinos or CRISPR approaches, then complementing with recombinant protein to assess functional recovery

  • Comparative expression analysis: Examining differential expression of R11 in regeneration-competent versus regeneration-incompetent stages of Xenopus development

Research has demonstrated that targeted induction of apoptosis in Xenopus tissues results in significant tissue-specific regenerative responses . For example, photoactivation of KillerRed in the developing eye leads to ablation of eye pigment, which can then be monitored for regenerative capacity. Similar approaches focused on R11 function during these processes can elucidate its specific role in the regenerative program.

What emerging technologies might enhance our understanding of Xenopus laevis Apoptosis regulator R11 function?

Several cutting-edge methodologies show promise for advancing our understanding of R11 biology:

  • CRISPR/Cas9-mediated genome editing: Creating precise R11 mutations in Xenopus to explore structure-function relationships in vivo

  • Single-cell transcriptomics and proteomics: Mapping R11 expression patterns across developmental stages and tissue types at unprecedented resolution

  • Advanced imaging techniques: Using super-resolution microscopy combined with tagged R11 variants to visualize subcellular localization during apoptosis

  • Computational modeling: Developing predictive models of R11 interactions based on structural data and evolutionary conservation patterns

These technologies will likely resolve current questions about the precise mechanisms through which R11 regulates apoptosis in Xenopus and how these mechanisms compare to mammalian systems. Integration of multiple approaches will be essential to develop a comprehensive understanding of R11's role in normal development and disease states.

How might studies of Xenopus laevis Apoptosis regulator R11 contribute to our understanding of human disease processes?

Comparative studies between Xenopus and mammalian apoptosis regulators offer valuable insights into evolutionary conservation and potential therapeutic targets. Amphibians like Xenopus laevis demonstrate remarkable cancer resistance compared to mammals , suggesting that understanding the unique properties of their apoptotic machinery, including R11, could reveal novel approaches to human disease treatment.

Methodologically, researchers exploring translational applications should:

  • Compare sequence homology and structural conservation between Xenopus R11 and human apoptosis regulators

  • Investigate functional complementation by testing whether Xenopus R11 can rescue apoptotic defects in mammalian systems

  • Identify unique protein-protein interactions in the Xenopus apoptotic network that might represent overlooked regulatory mechanisms in human cells

  • Explore how R11-dependent pathways contribute to the enhanced regenerative capacity of Xenopus tissues compared to mammalian counterparts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.