Recombinant Xenopus laevis Atlastin-2 (atl2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis Atlastin-2 (atl2)

Recombinant Xenopus laevis Atlastin-2 (atl2) is a protein derived from the African clawed frog, Xenopus laevis. Atlastin-2 is part of the atlastin family, which plays a crucial role in the fusion of endoplasmic reticulum (ER) membranes, contributing to the formation and maintenance of the ER network. This process is essential for cellular functions, including protein synthesis and lipid metabolism.

Function of Atlastin-2

Atlastin-2, like other atlastins, is a dynamin-like GTPase that mediates the fusion of ER tubules, forming a complex network of interconnected membranes. This network is vital for maintaining cellular homeostasis and facilitating communication between different parts of the cell. The ER network morphology changes during the cell cycle, with atlastin playing a key role in these transformations .

Structure and Mechanism

Atlastin proteins, including Atlastin-2, have a unique structure featuring intramembrane hairpin loops rather than traditional transmembrane domains. These loops do not span the membrane but are crucial for the protein's function in membrane fusion . The GTPase activity of atlastin is essential for its role in ER fusion, although the exact mechanism by which it facilitates membrane fusion is still under investigation.

Research Findings

Research on atlastin proteins has shown that they are critical for maintaining ER morphology. Depletion or dysfunction of atlastin proteins can lead to ER fragmentation and defects in cellular processes . In Xenopus laevis, egg extracts have been used extensively to study ER network formation and dynamics, highlighting the role of atlastin in these processes .

Applications and Availability

Recombinant Xenopus laevis Atlastin-2 is available as a recombinant protein, which can be used in various biochemical assays and research applications . This includes studying ER dynamics, membrane fusion mechanisms, and the role of atlastin in cellular processes.

Disease Association

Atlastin proteins, including Atlastin-2, are associated with neurodegenerative diseases such as spastic paraplegia. Mutations in the human atlastin gene (ATL1) are linked to spastic paraplegia type 3A, highlighting the importance of atlastin function in maintaining neuronal health .

Data Table: Key Features of Recombinant Xenopus laevis Atlastin-2

FeatureDescription
SourceXenopus laevis (African clawed frog)
FunctionMediates ER membrane fusion
StructureIntramembrane hairpin loops
GTPase ActivityEssential for membrane fusion
ApplicationsBiochemical assays, ER dynamics studies
Disease AssociationNeurodegenerative diseases (e.g., spastic paraplegia)

References

  1. Multiple mechanisms determine ER network morphology during the cell cycle .

  2. The atlastin membrane anchor forms an intramembrane hairpin that does not span the membrane .

  3. ATL2 Antibodies .

  4. REEP5 depletion causes sarco-endoplasmic reticulum vacuolization .

  5. UniProt Entry for Atlastin-2 .

  6. ELISA Recombinant Xenopus laevis Atlastin-2 .

  7. ATL2 Gene - GeneCards .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atl2; arl6ip2; Atlastin-2; ADP-ribosylation factor-like protein 6-interacting protein 2; ARL-6-interacting protein 2; Aip-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-569
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
atl2
Target Protein Sequence
MAEGGSLRNRTRFGSRSNEAMNHVDYPDENFVEEIQLNSDTEVMEKPRPIQIVLAHEDDH NFELDETALESILMQDHIRDLNVVVLSVAGAFRKGKSFLLDFMLRFMYSQSSSWIGGNYE PLTGFTWRGGCERETTGIQIWSEVFVVEKPDGSKVAVILMDTQGAFDSQSTIKDCATVFA LSTMTSSVQVYNLSQNIQEDDLQHLQLFTEYGRLAMEEIYKKPFQTLMFLIRDWSYPYEH SYGLEGGNKFLEKRLQVKQNQHEELQNVRKHIHSCFTNIGCFLLPHPGLKVATNPYFDGR LVEIDDEFKKELRELVPLLLAPENLVEKEISGSKVTCRDLLEYFKAYIKIYQGEELPHPK SMLQATAEANNMAAVAGAKDTYSRSMEQVCGGDKPYIAPSDLERKHLDLKETCIKQFRSV KKMGGEEFCRRYQEQLEAEIEETYANFLKHNDGKNIFYAARTPATLFAVMFAMYIISGLT GFIGMNSIATICNLIMGLTLLSFCTWAYVKYSGEFRELGTLIDQIAEIIWEQLLKPLSDN LMEDNIRQTVRNSIKAGLTDQVSGRLKTN
Uniprot No.

Target Background

Function
Atlastin-2 (atl2) is a GTPase that tethers membranes via the formation of trans-homooligomers and mediates homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis.
Database Links

KEGG: xla:444436

UniGene: Xl.46763

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.