Recombinant Xenopus laevis ATPase family AAA domain-containing protein 3-A (atad3-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis ATPase Family AAA Domain-Containing Protein 3-A (atad3-a)

Recombinant Xenopus laevis ATPase family AAA domain-containing protein 3-A (atad3-a) is a synthetic, full-length mitochondrial protein expressed in E. coli and purified for research applications. This 593-amino acid protein (UniProt ID: Q58E76) is His-tagged for affinity chromatography and maintains >90% purity via SDS-PAGE analysis . Its primary function involves mitochondrial nucleoid organization, mtDNA segregation, and interactions with mitochondrial proteins like TFAM and prohibitin .

Domain Architecture

atad3-a contains distinct structural motifs critical for its mitochondrial localization and function:

DomainLocationFunction
N-terminal coiled-coilResidues 1-245Oligomerization scaffold; required for ATAD3A dimerization
Transmembrane domainsResidues 246-345Anchors protein to inner mitochondrial membrane (IMM)
Walker A/B motifsResidues 350-400ATP-binding and hydrolysis; essential for ATPase activity
C-terminal ATPase domainResidues 401-593Catalyzes ATP hydrolysis; regulates mitochondrial dynamics

The Walker A motif (GPPGTGKTL) is conserved across species, with glycine residues critical for nucleotide binding .

Key Activities

  1. Mitochondrial Nucleoid Organization:

    • Stabilizes mtDNA D-loops and interacts with TFAM, prohibitin, and mTERF18 to regulate nucleoid distribution and transcription .

    • Depletion disrupts mtDNA segregation and increases mtDNA copy number .

  2. Mitochondrial Dynamics and ER-Mitochondria Tethering:

    • Localizes to mitochondrial-associated membranes (MAMs) and facilitates ER-mitochondria interactions .

    • Overexpression or oligomerization induces mitochondrial fragmentation via Drp1 recruitment .

  3. Metabolic Regulation:

    • Modulates cholesterol metabolism and steroidogenesis by channeling lipids to mitochondria .

Oligomerization and Neurodegeneration

ModelObservationFunctional Impact
Huntington’s Disease (HD)Increased ATAD3A dimers in HD patient fibroblasts and mouse striatum Links mitochondrial fragmentation to neurodegeneration
Alzheimer’s Disease (AD)Elevated ATAD3A oligomers in 5XFAD mice and AD patient hippocampus Enhances ER-mitochondria tethering and cognitive deficits
Drosophila ModelsΔCC mutants (lacking coiled-coil domains) abolish oligomerization Demonstrates structural dependence of oligomerization

Mechanistic Insights:

  • ATAD3A Oligomerization:

    • Requires N-terminal coiled-coil domains .

    • Pathological oligomerization in HD and AD correlates with mitochondrial dysfunction and cognitive decline .

  • Therapeutic Targeting:

    • Heterozygous ATAD3A knockout reduces oligomerization and improves spatial memory in 5XFAD AD mice .

Recombinant atad3-a Properties

ParameterSpecification
SourceXenopus laevis (African clawed frog)
HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Molecular Weight66,894 Da (partial construct) ; full-length: ~66 kDa
Storage-20°C/-80°C; avoid freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Applications in Research

  • Structural Biology:

    • Study ATPase domain conformation and oligomerization using crosslinking or cryo-EM .

  • Disease Modeling:

    • Investigate ATAD3A mutations (e.g., Walker A p.G355D) linked to neurological syndromes .

  • Biochemical Assays:

    • Measure ATPase activity or mtDNA binding in vitro .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please specify this in your order; we will prioritize its development.
Synonyms
atad3-a; ATPase family AAA domain-containing protein 3-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
atad3-a
Target Protein Sequence
MSWLFGLNKGQQEPPGVPGFPEPPSPPGGSGDGGDKNKPKDKWSNFDPTGLERAAKAARE LDQSRHAKEAINLAKVQEETLQMEQQAKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETK QHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEDSVQKQEAMRRATVEHEMELRHKN EMLRIEAEARAQAKVERENADIIREQIRLKAAEHRQTVLESIKTAGTVFGEGFRTFISDW DKVTATVAGLTLLAVGVYTAKNATGVAGRYIEARLGKPSLVRDTSRITVAEAVKHPIKIT KRLYSKIQDALEGVILSPRLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKK LAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEK ISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERL VRLYFDKYVLQPASEGKQRLKVAQFDYGKKCSELSKLTEGMSGREISKLGVAWQAAAYAS EDGILTEAMIDARVADAIRQHQQKMAWLKAEGKEGAKEIGKNPLQPLLEGTQV
Uniprot No.

Target Background

Function

Essential for mitochondrial network organization, mitochondrial metabolism, and cell growth at both the organismal and cellular levels. It may play a significant role in mitochondrial protein synthesis and participate in mitochondrial DNA replication. It may also bind to mitochondrial DNA D-loops, contributing to nucleoid stability. Furthermore, it is required for enhanced cholesterol channeling in hormone-dependent steroidogenesis.

Database Links

KEGG: xla:734380

UniGene: Xl.66251

Protein Families
AAA ATPase family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.

Q&A

What is ATAD3-A and what is its cellular localization?

ATAD3-A (ATPase family AAA domain-containing protein 3-A) is a mitochondrial protein approximately 600 amino acids in length that is highly conserved across diverse eukaryotic lineages but notably absent in Fungi and Amoebozoa . The protein is anchored in the inner mitochondrial membrane with its C-terminal AAA+ domain extending into the mitochondrial matrix and its N-terminal domain (previously designated as DUF3523 but renamed ATAD3_N) located primarily in the inner membrane space . Some research suggests that the N-terminal domain may extend to the cytosol, potentially interacting with the endoplasmic reticulum at mitochondrial-ER contact sites . This unique topological arrangement allows ATAD3-A to potentially facilitate communication between different cellular compartments and participate in multiple mitochondrial functions.

How should recombinant ATAD3-A be stored and handled for optimal activity?

For optimal storage and handling of recombinant Xenopus laevis ATAD3-A:

  • Upon receipt, briefly centrifuge the vial before opening to bring the contents to the bottom .

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Add glycerol to a final concentration of 5-50% (50% is recommended) and aliquot for long-term storage .

  • Store at -20°C/-80°C for long-term storage .

  • For working aliquots, store at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as they may compromise protein integrity and activity .

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What experimental techniques are most effective for studying ATAD3-A function?

Several experimental approaches have proven effective for investigating ATAD3-A function:

  • Chemical Genetics Approaches: The development of ASPIR-1 (Allele-Specific, Proximity-Induced Reactivity-based inhibitor-1) demonstrates how engineered cysteine mutations combined with tailored inhibitors can allow for selective inhibition and functional analysis of AAA proteins . While this approach was developed for katanin (another AAA protein), the principles could be adapted for ATAD3-A research.

  • Thermal Shift Assays: These have been successfully employed to assess the stability of AAA proteins and their interactions with nucleotides and small molecules . For instance, when studying katanin (which shares the AAA+ domain architecture with ATAD3-A), researchers observed a +4 to +6°C shift in melting temperature in the presence of ADP .

  • Mutational Analysis: Creating variability hotspot mutations can generate functionally active variants for structure-function studies. This approach identifies less conserved residues in the ATP-binding site that can be replaced without compromising fundamental biochemical activity .

  • Mitochondrial Morphology and Function Assays: Since ATAD3-A disruption affects mitochondrial morphology, cristae structure, and oxidative phosphorylation complexes, techniques like electron microscopy, Blue Native PAGE for respiratory chain complex analysis, and live-cell imaging of mitochondrial networks are valuable .

  • Nucleoid Analysis: Given ATAD3-A's proximity to mitochondrial nucleoids, techniques to visualize and analyze nucleoid structure (such as super-resolution microscopy) can reveal important functional aspects .

What phenotypes are observed when ATAD3-A is disrupted in model systems?

Disruption of ATAD3-A across different model systems produces consistent, pleiotropic phenotypes:

Model SystemObserved Phenotypes
Metazoans (general)Essential for viability, multiple mitochondrial defects
Plants (Arabidopsis)Reduced growth, aberrant mitochondrial morphology, diffuse nucleoids, reduced oxidative phosphorylation complex I
Human disease modelsLinked to multiple mitochondrial-based diseases

In more detail, ATAD3-A disruption leads to:

  • Altered mitochondrial morphology and cristae structure

  • Reduced activity of respiratory chain complexes, particularly complex I and V

  • Changes in mitochondrial nucleoid structure and impaired mitochondrial DNA replication

  • Disrupted lipid metabolism

  • Abnormalities at contact sites between inner and outer mitochondrial membranes and at mitochondrial-ER contact sites

These consistent phenotypes across evolutionarily distant organisms underscore the essential and conserved nature of ATAD3-A function in eukaryotic mitochondria.

How does ATAD3-A differ mechanistically from other AAA domain-containing proteins?

ATAD3-A exhibits several unique features that distinguish it from other AAA domain-containing proteins:

  • Pore Loop Structure: Unlike classic AAA+ proteins that contain the aromatic pore loop 1 motif (Φ-X-Ar-Φ-X), ATAD3 proteins have a Pro-Φ-Gly motif . This fundamental difference may influence substrate specificity and processing mechanisms.

  • Membrane Anchoring: While many AAA proteins are soluble, ATAD3-A is anchored in the inner mitochondrial membrane, positioning its functional domains in different compartments .

  • Dual Compartment Interaction: ATAD3-A's unique topology allows it to potentially interact with components in both the mitochondrial matrix and the intermembrane space, possibly extending to the cytosol and ER .

  • Nucleoid Association: ATAD3-A has been implicated in mitochondrial nucleoid organization, a specialized function not shared by many other AAA proteins .

  • Evolutionary Distribution: Unlike many AAA proteins that are ubiquitous across eukaryotes, ATAD3 proteins arose deep in the eukaryotic lineage but are absent in Fungi and Amoebozoa .

These distinctions suggest that ATAD3-A has evolved specialized functions within mitochondria that are not replicated by other AAA+ family members.

What is the emerging role of ATAD3-A as a biomarker in cancer research?

Recent studies have identified ATAD3-A as a potential biomarker in cancer research, particularly in bladder cancer:

  • Expression Patterns: ATAD3-A expression is significantly higher in bladder cancer tissues compared to normal bladder mucosa, as demonstrated by analyses using UALCAN and Oncomine public databases and validated through immunohistochemistry of 491 bladder cancer specimens and 110 normal adjacent tissues .

  • Clinical Correlations: High expression of ATAD3-A correlates with several clinicopathological features in bladder cancer patients, including:

    • Patient age

    • Tumor size

    • Number of tumors

    • Distant metastasis

    • Lymph node metastasis

    • Lymphovascular invasion

    • TNM stage

  • Prognostic Value: Overexpression of ATAD3-A is closely associated with decreased patient survival. The mean survival time of bladder cancer patients with high ATAD3-A expression was significantly shorter than those with low expression levels .

  • Diagnostic Potential: The upregulation of ATAD3-A may serve as an effective indicator for diagnosing bladder cancer and predicting tumor progression .

These findings suggest that ATAD3-A might not only serve as a biomarker but could also represent a potential therapeutic target in cancer treatment strategies.

How do researchers apply chemical genetics approaches to study ATAD3-A and other AAA proteins?

Chemical genetics approaches have emerged as powerful tools for studying AAA proteins, with potential applications for ATAD3-A research:

  • RADD Approach (Reactive-site Accessible Difference Detection): This method has been used to characterize how inhibitors bind to the ATP-binding site of AAA proteins like katanin . The approach involves:

    • Identifying "variability hotspot residues" in the ATP-binding site that are less conserved across the AAA family

    • Creating mutations at these sites that retain protein activity

    • Screening for compounds that selectively bind and inhibit specific protein variants

  • ASPIR Development: The development of ASPIR-1 (Allele-Specific, Proximity-Induced Reactivity-based inhibitor-1) demonstrates a sophisticated approach where:

    • A low-affinity triazolopyridine-based fragment that binds to the ATP-binding site is identified

    • The inhibitor scaffold is modified with a reactive functional group

    • A biochemically silent cysteine mutation is introduced at a strategic position

    • The modified inhibitor undergoes proximity-induced reaction with the engineered cysteine

  • Allele-Specific Inhibition: This strategy allows researchers to achieve selective inhibition of engineered protein variants in cellular contexts. For example, ASPIR-1 treatment increased the accumulation of CAMSAP2 at microtubule minus-ends only in cells expressing cysteine-mutant katanin, confirming specific on-target activity .

  • Cross-Applicability: The approach has been successfully extended to other AAA proteins, including human VPS4B and FIGL1, demonstrating its versatility for studying proteins involved in diverse cellular processes .

For ATAD3-A research specifically, these approaches could be adapted by:

  • Identifying variability hotspots in the ATAD3-A ATP-binding site

  • Designing cysteine mutations that maintain protein function

  • Developing selective inhibitors based on the ASPIR concept

  • Validating inhibition through phenotypic assays focused on ATAD3-A functions

How conserved is ATAD3-A across species and what does this suggest about its function?

ATAD3-A exhibits a unique evolutionary distribution and conservation pattern that provides insights into its function:

  • Evolutionary Origin: ATAD3 proteins arose deep in the eukaryotic lineage but are notably absent in Fungi and Amoebozoa . This suggests that while the protein performs essential functions in many eukaryotes, alternative mechanisms evolved in these lineages.

  • Conservation in Metazoans: ATAD3 proteins are essential in diverse metazoans including Drosophila, Caenorhabditis elegans, and mammals . The high degree of conservation across these diverse organisms underscores its fundamental importance.

  • Plant Evolution: In Arabidopsis thaliana, there are four ATAD3 genes in two distinct clades that first appear in seed plants . Both clades are essential for viability, suggesting independent functional specialization.

  • AAA Domain Conservation: The AAA domain of Xenopus laevis katanin (another AAA protein) shows ~93% identity to the human ortholog . While this specific comparison is for katanin, it demonstrates the high conservation typical of AAA domains across vertebrates.

  • Functional Implications: The conservation of ATAD3-A across diverse lineages, coupled with the consistent phenotypes observed when the protein is disrupted, suggests it performs core mitochondrial functions that evolved early and have been maintained through evolutionary history .

The combination of broad conservation across major eukaryotic groups, alongside lineage-specific absences and duplications, suggests that ATAD3-A performs essential functions that can occasionally be compensated by alternative mechanisms during evolution.

What experimental design considerations are important when using Xenopus laevis ATAD3-A as a model for human ATAD3A research?

When using Xenopus laevis ATAD3-A as a model for human ATAD3A research, several important experimental design considerations should be addressed:

By carefully addressing these considerations, researchers can maximize the translational value of findings derived from studies using Xenopus laevis ATAD3-A while properly accounting for species-specific differences.

What are the recommended protocols for reconstituting and handling recombinant Xenopus laevis ATAD3-A?

For optimal reconstitution and handling of recombinant Xenopus laevis ATAD3-A, follow this detailed protocol:

  • Preparation:

    • Centrifuge the vial briefly before opening to bring the contents to the bottom

    • Prepare sterile deionized water and sterile pipettes for reconstitution

    • Chill glycerol solution (if adding for long-term storage)

  • Reconstitution:

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Gently mix by pipetting or inversion until completely dissolved

    • Avoid vigorous vortexing which may cause protein denaturation

  • Long-term Storage Preparation:

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Mix thoroughly but gently to ensure even distribution

    • Aliquot into smaller volumes to minimize freeze-thaw cycles

  • Storage Conditions:

    • For long-term storage: -20°C or -80°C (preferred)

    • For working aliquots: 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Quality Control Check:

    • If necessary, perform SDS-PAGE analysis to confirm protein integrity

    • Expected purity should be greater than 90% as determined by SDS-PAGE

  • Experimental Use Considerations:

    • Thaw aliquots on ice before use

    • Centrifuge briefly to collect contents at the bottom of the tube

    • For ATPase activity assays, ensure appropriate buffer conditions containing required cofactors

This protocol ensures the maintenance of protein stability and activity for experimental applications, minimizing the risk of degradation or activity loss.

What advanced techniques can be used to study the interaction of ATAD3-A with mitochondrial membranes and nucleoids?

Investigating ATAD3-A's interactions with mitochondrial membranes and nucleoids requires sophisticated approaches:

  • Super-resolution Microscopy:

    • Techniques like STED (Stimulated Emission Depletion), PALM (Photoactivated Localization Microscopy), or STORM (Stochastic Optical Reconstruction Microscopy)

    • Can resolve the precise localization of ATAD3-A relative to nucleoids and membrane contact sites

    • Allows visualization of dynamic interactions in living cells when combined with appropriate fluorescent tagging strategies

  • Proximity Labeling Methods:

    • BioID or APEX2-based approaches can identify proteins in close proximity to ATAD3-A

    • Engineered ATAD3-A fused with biotin ligase (BioID) or peroxidase (APEX2) can biotinylate nearby proteins

    • Biotinylated proteins can be purified and identified by mass spectrometry

    • Particularly valuable for mapping the interactome at different cellular compartments

  • Crosslinking Mass Spectrometry (XL-MS):

    • Chemical crosslinkers can capture transient interactions between ATAD3-A and partner proteins or nucleic acids

    • Combined with mass spectrometry to identify interaction partners and sites

    • Can provide structural information about protein complexes

  • Cryo-Electron Tomography:

    • Allows visualization of ATAD3-A in its native membrane environment

    • Can capture the three-dimensional organization of ATAD3-A at membrane contact sites

    • When combined with gold-labeled antibodies, can specifically locate ATAD3-A within the complex mitochondrial architecture

  • Nucleoid Isolation and Analysis:

    • Protocols for isolating intact mitochondrial nucleoids can be combined with immunoprecipitation of ATAD3-A

    • ChIP-seq (Chromatin Immunoprecipitation followed by sequencing) can identify specific mtDNA regions associated with ATAD3-A

    • Native gel electrophoresis can preserve nucleoid-protein complexes for further analysis

  • Liposome Reconstitution Assays:

    • Recombinant ATAD3-A can be reconstituted into liposomes of defined composition

    • Allows investigation of membrane remodeling activities and lipid preferences

    • Can be combined with electron microscopy to visualize membrane structures

  • FRET (Förster Resonance Energy Transfer):

    • Can detect molecular-scale interactions between fluorescently labeled ATAD3-A and potential binding partners

    • Particularly useful for studying dynamic interactions in living cells

    • Can provide quantitative data on binding affinities and kinetics

These advanced techniques, particularly when used in combination, can provide comprehensive insights into the complex interactions of ATAD3-A with mitochondrial membranes and nucleoids, advancing our understanding of its essential functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.