Recombinant Xenopus laevis ATPase family AAA domain-containing protein 3-B (atad3-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atad3-b; ATPase family AAA domain-containing protein 3-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
atad3-b
Target Protein Sequence
MSWLFGLNRGQPEPPGVPGFPEPPSPPGGSGDGGDKNRPKDKWSNFDPTGLERAAKAARE LDQSRHAKEALNLAKVQEETLQMEQQAKIKEYEAAVEQIKNEQIRVQSEEKRKTLNEETK QHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKN DMLRIEAEAHARAKVERENADIIREQIRLKAAEHRQTVLESIKTAGTVFGEGFRTFISDW DKVTATVAGLTLLAVGVYTAKNGTGVAGRYIEARLGKPSLVRDTSRITVVEAIKHPIKIS KRIFSKIQDALEGVILSPRLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKK LAMHSSMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEK ISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERL VRLYFDKYVLQPASEGKQRLKVAQFDYGKKCSELATLTEGMSGREISKLGVAWQAAAYAS EDGILTEAMIDARVADAIRQHQQKMEWLKAEGKESTKEIGKNPLQPLLEGTPV
Uniprot No.

Target Background

Function

Function: Essential for mitochondrial network organization, mitochondrial metabolism, and cell growth at both organismal and cellular levels. It plays a crucial role in mitochondrial protein synthesis, potentially participating in mitochondrial DNA replication. It may bind to mitochondrial DNA D-loops, contributing to nucleoid stability. Furthermore, it's required for enhanced cholesterol channeling in hormone-dependent steroidogenesis.

Database Links

KEGG: xla:398759

UniGene: Xl.15137

Protein Families
AAA ATPase family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion matrix, mitochondrion nucleoid.

Q&A

What is the functional role of ATAD3-B in Xenopus laevis mitochondria?

ATAD3-B in Xenopus laevis functions as a mitochondrial protein involved in maintaining mitochondrial DNA (mtDNA) integrity. While ATAD3-B in primates has been extensively characterized as a mitophagy receptor that promotes clearance of damaged mtDNA, the Xenopus ortholog shares structural similarities but may exhibit functional differences due to evolutionary divergence . Experimental evidence indicates that ATAD3-B participates in nucleoid organization, where mtDNA and associated proteins form complexes essential for mitochondrial function. The protein is part of a larger complex that includes other nucleoid-associated proteins such as TFAM, POLG, and prohibitins, contributing to mtDNA packaging and maintenance in Xenopus systems . Unlike its primate counterpart, Xenopus ATAD3-B may exhibit species-specific adaptations that reflect its phylogenetic position between aquatic vertebrates and land tetrapods .

How can researchers effectively express and purify recombinant Xenopus laevis ATAD3-B for experimental studies?

For successful expression and purification of recombinant Xenopus laevis ATAD3-B, researchers should consider a bacterial expression system using E. coli with a His-tag for affinity purification . The full-length protein (1-593 amino acids) can be expressed using the following methodological approach:

  • Clone the full-length Xenopus laevis ATAD3-B coding sequence into an expression vector containing a His-tag sequence

  • Transform the construct into an E. coli expression strain optimized for eukaryotic protein expression

  • Induce protein expression using IPTG under controlled temperature conditions (typically 18-25°C to enhance proper folding)

  • Lyse cells under native conditions and purify using Ni-NTA affinity chromatography

  • Perform size exclusion chromatography to ensure protein homogeneity

  • Verify protein integrity through SDS-PAGE and Western blotting with anti-His antibodies

This approach yields purified recombinant ATAD3-B suitable for biochemical assays, structural studies, and functional characterization experiments.

What experimental systems are most appropriate for investigating ATAD3-B function in Xenopus laevis?

The Xenopus laevis experimental system offers several advantages for investigating ATAD3-B function. Researchers should consider the following methodological approaches:

  • Tadpole brain injection models: Direct injection of constructs expressing tagged ATAD3-B can be used to study neuronal expression patterns and subcellular localization, similar to approaches used with rabies virus for neural circuit studies

  • Cell line derivation: Establishing Xenopus cell lines with stable ATAD3-B expression or knockout provides controlled systems for biochemical and functional studies

  • Transgenic approaches: Creating transgenic Xenopus expressing modified ATAD3-B variants under tissue-specific promoters enables in vivo functional studies during development

  • Immunohistochemical analysis: Using post-hoc immunostaining techniques to visualize ATAD3-B expression patterns in relation to mitochondrial markers provides insights into subcellular distribution

The choice between these systems depends on the specific research question, with tadpole models being particularly valuable for developmental studies and cell-based systems offering advantages for biochemical characterization .

How does ATAD3-B interact with mitochondrial DNA in Xenopus laevis compared to its primate counterparts?

The interaction between ATAD3-B and mitochondrial DNA in Xenopus laevis shows both conserved and divergent features compared to primate orthologs. In primates, ATAD3B forms hetero-oligomers with ATAD3A to establish a connection with mtDNA, creating an ATAD3B-ATAD3A-mtDNA axis that regulates mitophagy under oxidative stress conditions .

Xenopus laevis ATAD3-B likely maintains the ability to interact with mtDNA nucleoids but exhibits species-specific properties. Comparative analysis suggests that while the basic mtDNA-binding domains are conserved, the C-terminal region shows greater divergence. Unlike primate ATAD3B, which contains an additional 62 amino acids at the C-terminus compared to ATAD3A with a functional LIR motif (Y604 and L607) that binds LC3B, the Xenopus ortholog may utilize different mechanisms for mitochondrial quality control .

Research methodologies to investigate these differences include:

  • In vitro DNA binding assays comparing Xenopus and human ATAD3-B

  • Co-immunoprecipitation studies to identify Xenopus-specific ATAD3-B binding partners

  • Chimeric protein experiments swapping domains between species to identify functionally critical regions

These approaches reveal that while the fundamental mtDNA-binding capability is likely conserved across species, the regulatory mechanisms and downstream signaling pathways may have evolved distinct features in amphibians versus mammals .

What techniques can be implemented to study ATAD3-B-mediated mitophagy in Xenopus model systems?

To investigate ATAD3-B-mediated mitophagy in Xenopus model systems, researchers should employ a multi-faceted approach that combines molecular, cellular, and imaging techniques:

  • mito-Keima assay adaptation: The mito-Keima fluorescent protein that changes spectral properties in acidic environments can be adapted for Xenopus systems to quantitatively measure mitophagy events. This approach, similar to that used in human cells , involves:

    • Creating Xenopus cell lines expressing mito-Keima

    • Exposing cells to oxidative stressors (H₂O₂ or 3-NPA)

    • Monitoring mitophagy through confocal microscopy and flow cytometry

  • CRISPR/Cas9 genome editing: Generate ATAD3-B knockout or modified Xenopus lines to assess mitophagy defects:

    • Design sgRNAs targeting Xenopus ATAD3-B

    • Create knockout lines and assess mitochondrial phenotypes

    • Complement with re-expression of wild-type or mutant ATAD3-B

  • mtDNA damage assessment: Quantify oxidative damage to mtDNA using:

    • Anti-8-oxo-dG immunofluorescence to measure oxidized DNA

    • qPCR-based mtDNA amplification efficiency to assess lesion frequency

    • Long-range PCR to detect large-scale mtDNA deletions

  • Interaction studies: Assess ATAD3-B interactions with autophagy machinery:

    • Co-immunoprecipitation with LC3 and other autophagy components

    • GST pull-down assays to identify direct binding partners

    • Immunofluorescence co-localization studies of ATAD3-B with mitophagy markers

This comprehensive methodology allows researchers to characterize the evolutionarily conserved and divergent aspects of ATAD3-B-mediated mitophagy in amphibian systems.

How can recombinant ATAD3-B be utilized to investigate potential therapeutic approaches for mitochondrial diseases?

Recombinant Xenopus laevis ATAD3-B represents a valuable tool for investigating therapeutic approaches for mitochondrial diseases through several methodological strategies:

  • Heteroplasmy modulation studies: Research indicates that ATAD3B re-expression in human cells containing the m.3243A>G mutation (associated with MELAS syndrome) promotes clearance of mutated mtDNA . Similar approaches with Xenopus ATAD3-B can:

    • Assess conservation of this therapeutic mechanism across species

    • Identify critical domains required for mtDNA quality control

    • Develop amphibian models of mtDNA heteroplasmy for screening interventions

  • Structure-function relationship analysis: Recombinant protein can be used to:

    • Characterize the LIR motif or equivalent functional domains in Xenopus ATAD3-B

    • Perform mutagenesis studies to identify therapeutic enhancement opportunities

    • Develop protein delivery methods for mitochondrial targeting

  • Drug screening platforms: Xenopus-based systems with recombinant ATAD3-B allow:

    • High-throughput screening of compounds that enhance ATAD3-B activity

    • Identification of molecules that promote beneficial ATAD3-B conformational changes

    • Testing of drugs that modulate ATAD3-B-mediated mitophagy without toxicity

  • Evolutionary medicine approach: Comparative studies between Xenopus and human ATAD3-B can:

    • Identify naturally evolved mechanisms for mtDNA quality control

    • Leverage species differences to discover novel therapeutic targets

    • Develop chimeric proteins with enhanced therapeutic properties

This research direction is particularly promising since studies show that human ATAD3B contains a LIR motif that binds LC3 and promotes clearance of damaged mtDNA under oxidative stress conditions, suggesting that modulating ATAD3B activity could be therapeutically beneficial for mitochondrial diseases .

What molecular mechanisms dictate ATAD3-B localization within mitochondrial compartments in Xenopus systems?

The intramitochondrial localization of ATAD3-B in Xenopus systems involves complex molecular mechanisms that determine its distribution between mitochondrial compartments. Based on research with mammalian orthologs, several factors likely regulate ATAD3-B positioning:

  • Oligomerization-dependent localization: In mammalian systems, ATAD3B hetero-oligomerizes with ATAD3A, promoting targeting of the C-terminal region to the mitochondrial intermembrane space under normal conditions . In Xenopus, similar mechanisms likely operate:

    • Under basal conditions, ATAD3-B may form oligomeric complexes that anchor its C-terminus in the intermembrane space

    • Stress conditions may alter these interactions, potentially repositioning portions of the protein

  • Stress-responsive membrane dynamics: Oxidative stress induces conformational changes that expose the C-terminus of mammalian ATAD3B at the mitochondrial outer membrane . In Xenopus systems:

    • Oxidative stressors like H₂O₂ or 3-NPA may trigger similar relocalization

    • mtDNA damage likely serves as a molecular trigger for this conformational change

    • The repositioning enables interaction with cytosolic factors

  • Topological arrangement: ATAD3-B exhibits a complex topology spanning multiple mitochondrial compartments:

    • N-terminal domain likely resides in the mitochondrial matrix

    • Transmembrane segments anchor the protein in the inner membrane

    • C-terminal portion can dynamically relocate between intermembrane space and outer membrane

  • Experimental approaches to study localization:

    • Protease protection assays with isolated Xenopus mitochondria

    • Immunoelectron microscopy for precise subcompartmental localization

    • Fluorescence resonance energy transfer (FRET) to detect conformational changes

    • Super-resolution microscopy to visualize dynamic repositioning events

This dynamic localization mechanism appears central to ATAD3-B function, as it determines accessibility to interaction partners and may represent an evolutionarily conserved mechanism for sensing and responding to mitochondrial stress.

How does the LC3 interaction domain of ATAD3-B differ between Xenopus laevis and primate models, and what are the functional implications?

The LC3 interaction domain (LIR motif) of ATAD3-B exhibits significant differences between Xenopus laevis and primate models, with important functional implications for mitophagy regulation:

  • Structural comparison:

    • Primate ATAD3B contains three potential LIR motifs (LIR-1, LIR-2, and LIR-3), with only LIR-3 (involving Y604 and L607 residues) being functional for LC3B binding

    • This functional LIR-3 motif is located within the additional 62 amino acids at the C-terminus of primate ATAD3B that are absent in ATAD3A

    • Xenopus laevis ATAD3-B likely contains different or modified LIR motifs due to evolutionary divergence

  • Sequence analysis:

    SpeciesLIR motif locationCore LIR sequenceBinding capacity
    HumanC-terminal (LIR-3)Y604-X-X-L607Strong LC3B binding
    XenopusPredicted differentNot fully characterizedRequires experimental validation
  • Functional implications:

    • The presence and nature of LIR motifs directly affects the protein's ability to recruit LC3 and initiate mitophagy

    • Differences in the LIR domain may reflect species-specific adaptations in mitochondrial quality control

    • Primate-specific features may represent evolutionary adaptations for precise regulation of mtDNA integrity

  • Experimental approaches to characterize differences:

    • Site-directed mutagenesis of putative Xenopus LIR motifs

    • GST pull-down assays with Xenopus LC3 and ATAD3-B variants

    • Domain swapping experiments between human and Xenopus ATAD3-B

    • Functional mitophagy assays comparing wild-type and mutant constructs

The evolutionary divergence in this critical interaction domain suggests that while the general concept of ATAD3-B-mediated mitophagy may be conserved, the molecular mechanisms and regulatory controls have likely adapted to species-specific requirements for mitochondrial homeostasis.

What are the optimal conditions for expressing functional recombinant Xenopus laevis ATAD3-B in bacterial systems?

Optimizing expression conditions for functional recombinant Xenopus laevis ATAD3-B in bacterial systems requires careful consideration of multiple parameters:

  • Expression system selection:

    • E. coli BL21(DE3) or Rosetta strains are recommended for expressing eukaryotic proteins with rare codons

    • Consider using strains with enhanced disulfide bond formation capabilities (Origami, SHuffle) if the protein contains critical disulfide bridges

    • The pET expression system with T7 promoter provides tight regulation and high expression levels

  • Expression parameters optimization:

    ParameterRecommended ConditionRationale
    Temperature16-20°CLower temperatures reduce inclusion body formation
    IPTG concentration0.1-0.5 mMModerate induction prevents aggregation
    Growth media2XYT or TBRich media supports higher biomass
    Induction timingOD₆₀₀ = 0.6-0.8Mid-log phase optimizes expression
    Expression duration16-20 hoursExtended time at low temperature improves folding
  • Solubility enhancement strategies:

    • Include solubility-enhancing fusion tags (MBP, SUMO, or Thioredoxin) if His-tag alone yields poor solubility

    • Add 0.1-1% Triton X-100 or low concentrations of urea (1-2 M) to extraction buffers

    • Consider dual-detergent extraction systems for this membrane-associated protein

    • Test co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Functional validation methods:

    • ATP hydrolysis assays to confirm AAA domain functionality

    • Circular dichroism to verify proper secondary structure formation

    • Size exclusion chromatography to assess oligomeric state

    • Limited proteolysis to evaluate domain folding quality

These optimized conditions should yield milligram quantities of functional recombinant Xenopus laevis ATAD3-B suitable for downstream biochemical and structural studies.

How can researchers effectively design experiments to determine ATAD3-B's role in mitochondrial stress responses in Xenopus models?

Designing robust experiments to elucidate ATAD3-B's role in mitochondrial stress responses in Xenopus models requires a comprehensive approach:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated ATAD3-B knockout or knockdown in Xenopus cell lines or embryos

    • Morpholino oligonucleotide-based transient knockdown for developmental studies

    • Rescue experiments with wild-type versus mutant ATAD3-B constructs

    • Creation of transgenic Xenopus lines with fluorescently tagged ATAD3-B

  • Stress induction protocols:

    • Oxidative stress: Titrated H₂O₂ (100-500 μM) or 3-NPA (0.5-2 mM) exposure

    • mtDNA damage: Low-dose ethidium bromide treatment or targeted enzymatic digestion

    • Metabolic stress: Nutrient deprivation or electron transport chain inhibitors

    • Compare responses to equivalent stress levels in mammalian systems

  • Mitochondrial phenotyping approaches:

    • mtDNA integrity assessment via qPCR and 8-oxo-dG immunostaining

    • Mitochondrial membrane potential measurements using JC-1 or TMRM

    • Electron microscopy to evaluate ultrastructural changes

    • Respiratory capacity measurements using Seahorse or Clark-type electrodes

    • Mitophagy quantification using mito-Keima or mt-mCherry-GFP reporters

  • Molecular interaction analysis:

    • Co-immunoprecipitation under basal and stress conditions

    • Proximity labeling approaches (BioID or APEX) to identify stress-specific interactors

    • FRET-based assays to detect conformational changes upon stress

    • Cross-species comparison of interaction networks using orthologous proteins

  • Developmental context considerations:

    • Stage-specific analyses from embryo to tadpole to adult

    • Tissue-specific responses in brain versus other high-energy tissues

    • Integration with metamorphosis-related mitochondrial remodeling

This experimental framework provides a comprehensive approach to characterize ATAD3-B function across multiple mitochondrial stress conditions while leveraging the unique advantages of the Xenopus model system.

How can recombinant Xenopus laevis ATAD3-B contribute to comparative studies of mitochondrial quality control across evolutionary lineages?

Recombinant Xenopus laevis ATAD3-B represents a valuable tool for evolutionary comparative studies of mitochondrial quality control mechanisms, offering insights into both conserved and divergent features across vertebrate lineages:

  • Phylogenetic position advantage:

    • Xenopus occupies a strategic phylogenetic position between aquatic vertebrates and land tetrapods

    • ATAD3-B comparative studies can reveal adaptation patterns during the water-to-land transition

    • Analysis across species illuminates how mitochondrial quality control mechanisms evolved with changing metabolic demands

  • Structural comparative approaches:

    • Cross-species comparison of recombinant ATAD3-B proteins from fish, amphibians, and mammals

    • Domain-specific functional assays to identify evolutionarily conserved regions

    • Structural biology studies (X-ray crystallography, cryo-EM) to compare three-dimensional architecture

    • Biophysical characterization of protein-protein interactions across species

  • Functional conservation assessment:

    • Complementation studies testing whether Xenopus ATAD3-B can rescue defects in mammalian cells

    • Investigation of LIR motif functionality or equivalent mechanisms across species

    • Comparative analysis of stress-responsive relocalization mechanisms

    • Assessment of hetero-oligomerization capacity with evolutionarily diverse ATAD3A orthologs

  • Evolutionary medicine implications:

    • Identification of primate-specific innovations in mitophagy pathways

    • Discovery of potentially more efficient mitochondrial quality control mechanisms in non-mammalian vertebrates

    • Development of novel therapeutic approaches based on conserved ATAD3-B functions

    • Understanding how ATAD3-B functional changes correlate with the emergence of mitochondrial diseases

This comparative approach not only advances fundamental understanding of mitochondrial evolution but also holds promise for identifying novel therapeutic targets by revealing natural solutions to mitochondrial quality control that have emerged throughout vertebrate evolution.

What experimental approaches can determine if ATAD3-B's function in Xenopus models can be applied to develop therapies for human mitochondrial diseases?

To effectively translate findings from Xenopus ATAD3-B research to human therapeutic applications, researchers should implement a strategic translational research pipeline:

  • Cross-species functional comparison:

    • Express Xenopus ATAD3-B in human ATAD3B-deficient cells to assess complementation

    • Create chimeric proteins combining domains from Xenopus and human ATAD3B to identify functional modules

    • Perform side-by-side mitophagy assays in both species under identical stress conditions

    • Map conservation of post-translational modifications and regulatory mechanisms

  • Disease-relevant model systems:

    • Culture fibroblasts from MELAS patients (m.3243A>G mutation) for rescue studies

    • Develop CRISPR/Cas9-engineered Xenopus models harboring human mitochondrial disease mutations

    • Create cellularized mtDNA heteroplasmy models in Xenopus cells for intervention testing

    • Establish high-throughput screening platforms in both Xenopus and human cellular systems

  • Therapeutic mechanism exploration:

    • Identify the specific mechanisms by which ATAD3B promotes mutant mtDNA clearance

    • Determine whether ATAD3B enhances selective mitophagy of damaged mitochondria

    • Investigate if ATAD3B regulates mtDNA replication and distribution during cell division

    • Assess ATAD3B's interaction with mitochondrial quality control pathways beyond mitophagy

  • Therapeutic development approaches:

    ApproachMethodologyTranslational Potential
    Gene therapyAAV-mediated ATAD3B deliveryDirect enhancement of mitochondrial quality control
    Small molecule screeningLibraries tested in dual-species systemsIdentification of ATAD3B activity enhancers
    Peptide mimeticsBased on functional LIR motifsTargeted mitophagy enhancement
    Structure-based drug designUsing recombinant protein structuresDevelopment of specific modulators
  • Safety and efficacy assessment:

    • Test for potential negative consequences of ATAD3B overactivation

    • Evaluate effects on wild-type mtDNA stability and maintenance

    • Assess interaction with existing mitochondrial disease treatments

    • Determine tissue-specific efficacy and toxicity profiles

This comprehensive translational approach leverages the evolutionary insights from Xenopus models while establishing rigorous validation in human disease contexts, potentially leading to novel therapeutic strategies for mitochondrial disorders.

What are the current knowledge gaps in understanding ATAD3-B function in Xenopus laevis systems that require further investigation?

Despite significant advances in understanding ATAD3-B biology, several critical knowledge gaps remain in characterizing its function specifically in Xenopus laevis systems:

  • Developmental expression and regulation:

    • Comprehensive characterization of ATAD3-B expression patterns across developmental stages

    • Analysis of transcriptional and post-transcriptional regulatory mechanisms

    • Identification of developmental signals that modulate ATAD3-B activity

    • Comparison with mammalian developmental regulation patterns

  • Xenopus-specific protein interactions:

    • Systematic identification of ATAD3-B binding partners in Xenopus mitochondria

    • Characterization of potential amphibian-specific interactions absent in mammals

    • Investigation of tissue-specific interaction networks, particularly in high-energy tissues

    • Analysis of how these interactions change during metamorphosis-induced mitochondrial remodeling

  • Functional domains and motifs:

    • Detailed mapping of functional domains specific to Xenopus ATAD3-B

    • Identification of LIR motif equivalents or alternative autophagy-related binding sites

    • Characterization of AAA ATPase domain functionality and nucleotide hydrolysis properties

    • Determination of post-translational modifications regulating activity

  • Mitophagy mechanisms:

    • Whether Xenopus ATAD3-B mediates mitophagy through LC3-dependent or alternative pathways

    • The specific signals triggering ATAD3-B-mediated mitophagy in amphibian systems

    • How ATAD3-B-mediated mitophagy integrates with other mitochondrial quality control systems

    • The efficiency of selective damaged mtDNA clearance compared to mammalian systems

  • Physiological significance:

    • The contribution of ATAD3-B to Xenopus adaptation to environmental stressors

    • Its role in energy metabolism regulation during developmental transitions

    • Potential functions in immune response and regeneration unique to amphibians

    • Impact on longevity and aging processes in this model organism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.