Recombinant Xenopus laevis Beta-1 adrenergic receptor (adrb1)

Shipped with Ice Packs
In Stock

Description

Definition and Expression Characteristics

The recombinant Xenopus laevis Beta-1 adrenergic receptor (ADRB1) is a full-length protein (1–385 amino acids) expressed in E. coli with an N-terminal 10xHis-tag for purification and detection . Key details include:

PropertyDetails
Uniprot IDO42574
Product CodeCSB-CF001391XBE
Expression SystemIn vitro E. coli
TagN-terminal 10xHis-tag
Storage-20°C/-80°C (stable for 6–12 months depending on form: liquid or lyophilized)

This protein retains the structural and functional features of native ADRB1, enabling its use in biochemical assays and signaling studies .

Functional Mechanisms

ADRB1 mediates adrenergic signaling through multiple pathways:

Primary Signaling Pathways

PathwayMechanism
Gs-Protein CouplingActivation of adenylyl cyclase → cAMP production → PKA activation .
Beta-Arrestin RecruitmentMAPK pathway activation independent of G-proteins .
Gq/11-Protein CouplingPhospholipase C activation → IP3/DAG signaling → Ca²⁺ release .

Subtype Specificity

ADRB1 exhibits distinct pharmacological profiles compared to ADRB2:

  • Agonist Binding: Higher affinity for epinephrine over norepinephrine .

  • Antagonist Sensitivity: Selective blockade by beta-1 blockers (e.g., atenolol) .

Chimeric receptor studies in Xenopus oocytes revealed that transmembrane regions IV, VI, and VII are key determinants of subtype-specific ligand binding .

Receptor-Ligand Interactions

The recombinant ADRB1 is used to study:

  • Agonist/antagonist binding kinetics (e.g., epinephrine vs. norepinephrine) .

  • Structural determinants of subtype specificity via mutagenesis .

Heterodimerization Studies

ADRB1 forms heterodimers with ADRB2, altering functional properties:

  • Inhibited ADRB2 Internalization: Reduced β₂-AR degradation in co-expressed systems .

  • Suppressed ERK1/2 MAPK Activation: Loss of β₂-AR-mediated MAPK signaling in heterodimers .

Drug Development

ADRB1 serves as a target for beta-blockers and agonists in cardiovascular and neurological therapies .

Cloning and Expression

  • cDNA Cloning: The 2.4-kb cDNA encodes a 477-amino-acid protein with 69% homology to avian β-AR and 54% to human β₂-AR .

  • Functional Validation: Expression in Xenopus oocytes confirmed β₁-AR pharmacology (e.g., cAMP response to epinephrine) .

Pathway Involvement

ADRB1 participates in pathways critical for cardiac function:

PathwayKey Proteins
Adrenergic SignalingADRA1D, ADCY8, PPP2CA, CALM1, CACNG8 .
Calcium RegulationRGS5A, ADRB2, GJC2, CX34.4, CASQ1 .
EndocytosisRAB11FIP2, VPS26BL, STAM2, CDC42 .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
adrb1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor; x-BETA1AR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MGDGWGPMECRNRSGTPTTVPSPMHPLPELTHQWTMGMTMFMAAIILLIVMGNIMVIVAI GRNQRLQTLTNVFITSLACADLIMGLFVVPLGATLVVSGRWLYGSIFCEFWTSVDVLCVT ASIETLCVISIDRYIAITSPFRYQSLLTKGRAKGIVCSVWGISALVSFLPIMMHWWRDTG DPLAMKCYEDPGCCDFVTNRAYAIASSIISFYFPLIIMIFVYIRVFKEAQKQMKKIDKCE GRFSHSHVLSHGRSSRRILSKILVAKEQKALKTLGIIMGTFTLCWLPFFLANVVNVFYRN LIPDKLFLFLNWLGYANSAFNPIIYCRSPDFRKAFKRLLCCPKKADRHLHTTGELSRYSG GFVNSLDTNALGMCSECNGVRTSLD
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins.
Database Links

KEGG: xla:399337

UniGene: Xl.14992

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What is the Xenopus laevis Beta-1 adrenergic receptor and how does it compare to mammalian homologs?

The Xenopus laevis Beta-1 adrenergic receptor (ADRB1) is a G-protein coupled receptor that mediates physiological effects of epinephrine and norepinephrine. It belongs to the adrenergic receptor family, specifically the beta-adrenergic receptor subfamily. This receptor consists of 385 amino acids in Xenopus laevis and functions as a transmembrane protein involved in signal transduction pathways . Structural analysis reveals that the Xenopus ADRB1 shares significant homology with other vertebrate beta-adrenergic receptors but has distinct differences from its mammalian counterparts.

Comparative analysis shows that while the human beta-1 adrenergic receptor is 69% homologous with the avian beta AR, it shares less homology (only 54%) with the human beta-2 adrenergic receptor (beta 2AR) . This suggests evolutionary divergence between beta receptor subtypes is greater than between species for the same receptor subtype. The receptor's functional domains, including transmembrane regions, intracellular loops, and terminal domains, have specific roles in ligand binding, G-protein coupling, and signal transduction that are largely conserved across species despite sequence variations.

What are the key functional domains of the ADRB1 protein and their roles in receptor signaling?

The ADRB1 receptor contains several distinct functional domains that contribute to its signaling properties. The transmembrane spanning region IV appears to be the primary determinant of receptor subtype specificity, distinguishing beta-1 from beta-2 adrenergic receptors . The third intracellular loop, particularly a proline-rich region of 24 amino acids, is responsible for coupling efficiency to the G-protein Gs, with beta-1 adrenergic receptors generally coupling less efficiently than beta-2 receptors .

The C-terminal domain determines subtype-specific desensitization patterns when expressed in cellular models. Meanwhile, the N-terminal domain plays critical roles in receptor phosphorylation, association with cytoplasmic proteins, surface expression, and dimerization . Specifically, the asparagine residue at position 15 (N15) has been identified as a key N-glycosylation site that affects ADRB1 surface expression and dimerization compared to wild-type receptors . These functional domains work in concert to regulate ligand binding, signal transduction, receptor internalization, and desensitization processes that modulate physiological responses to catecholamines.

What signaling pathways does ADRB1 participate in, and how are they regulated?

ADRB1 participates in several critical signaling pathways that regulate diverse physiological functions. Based on pathway analysis, ADRB1 is involved in adrenergic signaling in cardiomyocytes, general adrenoceptor pathways, and amine ligand-binding receptor cascades . The receptor primarily signals through the Gs-adenylyl cyclase-cAMP pathway, leading to the activation of protein kinase A (PKA) and subsequent phosphorylation of downstream targets.

Regulation of ADRB1 signaling occurs through multiple mechanisms. Receptor desensitization is a key regulatory process that involves phosphorylation of the receptor by G protein-coupled receptor kinases (GRKs) following ligand binding, leading to β-arrestin recruitment and receptor internalization . The third intracellular loop and C-terminal domain play important roles in this desensitization process. Additionally, ADRB1 signaling can be modulated by receptor downregulation, cross-talk with other signaling pathways, and genetic polymorphisms that affect receptor function . Long-term regulation includes changes in receptor expression levels, which can occur in response to chronic stimulation or pathological conditions such as heart failure.

What expression systems are most effective for producing functional recombinant Xenopus laevis ADRB1?

Escherichia coli (E. coli) has been successfully employed as an expression system for producing recombinant Xenopus laevis ADRB1, as evidenced by commercially available preparations . The bacterial expression system offers advantages including high yield, cost-effectiveness, and established purification protocols. When expressing ADRB1 in E. coli, researchers typically incorporate affinity tags such as His-tags to facilitate purification while minimizing impact on receptor function.

Alternative expression systems include Xenopus laevis oocytes, which provide a more native-like environment for receptor folding and post-translational modifications. Research has demonstrated that expression of beta-1 adrenergic receptor protein in Xenopus laevis oocytes conveys adenylate cyclase responsiveness to catecholamines with typical beta-1 adrenergic receptor specificity . This contrasts with the typical beta-2 subtype specificity observed when human beta-2 adrenergic receptor cDNA is expressed in this system . Mammalian cell lines such as HEK293 cells are also viable options, particularly when studying receptor trafficking, complex formation, or when post-translational modifications are critical for the research question. Each expression system has distinct advantages depending on the research objectives, with E. coli being optimal for high-yield protein production and mammalian or Xenopus systems preferred for functional studies requiring native-like receptor behavior.

What are the optimal conditions for storing recombinant Xenopus laevis ADRB1 to maintain stability and activity?

For optimal storage of recombinant Xenopus laevis ADRB1, researchers should maintain the protein at -20°C for routine storage or at -80°C for extended preservation . The stability of the receptor is significantly affected by buffer composition, with glycerol-containing buffers (typically 10-20%) often used to prevent freeze-damage during storage. Stabilizing agents such as protease inhibitors may be added to prevent degradation during storage and thawing cycles.

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity. Working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles . The shelf life of liquid preparations is approximately 6 months at -20°C/-80°C, while lyophilized forms offer extended stability of up to 12 months at the same temperatures . Researchers should consider that storage stability is influenced by multiple factors including buffer components, storage temperature, and the intrinsic stability of the protein itself. When preparing samples for long-term storage, small aliquots are recommended to avoid repeated freezing and thawing of the entire stock. For experiments requiring extended activity periods, optimization of buffer conditions through stability screening may be necessary.

How can researchers effectively measure ADRB1 binding affinities and functional activity in experimental settings?

Researchers can employ several complementary techniques to measure ADRB1 binding affinities and functional activity. Radioligand binding assays using tritiated or iodinated beta-adrenergic ligands (such as [³H]CGP-12177 or [¹²⁵I]cyanopindolol) represent the gold standard for determining binding affinities (Kd values) and receptor densities (Bmax). These assays can be conducted using either saturation binding to determine Kd and Bmax, or competition binding to determine the inhibition constant (Ki) of unlabeled compounds.

For functional activity assessment, researchers frequently utilize cAMP accumulation assays since ADRB1 couples primarily to Gs proteins, leading to adenylyl cyclase activation and increased intracellular cAMP levels. Modern approaches include FRET-based biosensors that allow real-time monitoring of cAMP dynamics in living cells. Electrophysiological techniques in Xenopus oocyte expression systems can directly measure the functional consequences of receptor activation on ion channel activity . This approach has demonstrated that expression of beta-1 adrenergic receptor protein in Xenopus laevis oocytes conveys adenylate cyclase responsiveness to catecholamines with a beta-1 specific pharmacological profile .

Additional functional assays include measurement of downstream signaling events such as PKA activation, CREB phosphorylation, or calcium mobilization using fluorescent indicators. Bioluminescence resonance energy transfer (BRET) or FRET techniques can assess receptor conformational changes, dimerization, or interactions with signaling proteins such as β-arrestins or G proteins. These techniques collectively provide a comprehensive characterization of receptor pharmacology and signaling properties.

What approaches can be used to study ADRB1 structure-function relationships and identify critical residues?

Multiple complementary approaches can be employed to investigate structure-function relationships in ADRB1. Site-directed mutagenesis represents a fundamental technique where specific amino acids are substituted to assess their contribution to receptor function. This approach has revealed that the transmembrane spanning region IV is critical for receptor subtype specificity, while a proline-rich region within the third intracellular loop affects G-protein coupling efficiency .

Chimeric receptor construction, where segments from different receptor subtypes are exchanged, has been instrumental in delineating the functional domains of beta-adrenergic receptors. For example, chimeric β1/β2 receptors have contributed to understanding subtype-specific properties . This approach can be particularly powerful when comparing Xenopus ADRB1 with mammalian homologs to identify evolutionarily conserved functional domains.

Advanced structural biology techniques include X-ray crystallography and cryo-electron microscopy, which can provide atomic-level insights into receptor structure. While these techniques are challenging for membrane proteins, they have been successfully applied to related GPCRs. Molecular dynamics simulations complement experimental approaches by modeling receptor dynamics, ligand interactions, and conformational changes during activation. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of conformational flexibility or stability upon ligand binding. FRET-based sensors can be used to monitor real-time conformational changes in response to different ligands, potentially revealing biased signaling mechanisms.

How can researchers effectively study ADRB1 polymorphisms and their functional consequences?

To study ADRB1 polymorphisms and their functional implications, researchers can employ a multifaceted approach beginning with genetic screening to identify naturally occurring variants. DNA sequencing of receptor coding regions from diverse populations can reveal both common and rare polymorphisms. For Xenopus laevis ADRB1, comparing sequences with the human receptor can provide insights into evolutionarily conserved regions that may be particularly sensitive to mutation .

Site-directed mutagenesis can be used to introduce specific polymorphisms identified in population studies or to create artificial mutations at conserved sites. These mutant receptors can then be expressed in cellular systems for functional characterization. Pharmacological profiling of polymorphic receptors involves measuring changes in ligand binding affinities, G-protein coupling efficiencies, and downstream signaling pathways. For example, studies with human ADRB1 have identified polymorphisms such as G>T exchange at position 175 (59Ala>Ser) in the N-terminal region and several variations in the C-terminus including 1195C>T (399Arg>Cys) and 1252C>G (418Pro>Ala) .

Electrophysiological recordings in Xenopus oocytes expressing wildtype versus polymorphic receptors can directly measure functional differences in ion channel modulation . Computational approaches including molecular modeling and molecular dynamics simulations can predict how specific amino acid substitutions might affect receptor structure, dynamics, and interactions with ligands or signaling partners. Long-term cell culture studies can assess how polymorphic receptors respond to chronic stimulation, including patterns of desensitization, down-regulation, and resensitization.

How does Xenopus laevis ADRB1 differ from mammalian homologs in terms of pharmacological properties and signal transduction?

Xenopus laevis ADRB1 exhibits both conserved and distinctive pharmacological properties compared to mammalian homologs. While the core signaling mechanisms are preserved across species, including G-protein coupling and adenylyl cyclase activation, subtle differences exist in ligand specificity, binding affinity, and signal transduction efficiency. Xenopus ADRB1 consists of 385 amino acids compared to the 477 amino acid human beta-1 adrenergic receptor , suggesting potential differences in regulatory domains and post-translational modification sites.

Analysis of protein interaction networks reveals that ADRB1 interacts with numerous proteins including MAGI2, MAGI3, Dlg4, GPRASP1, and Dlg1 . These interaction patterns may differ between Xenopus and mammalian systems, potentially leading to species-specific signaling outcomes despite conservation of the primary signaling pathways. From an evolutionary perspective, the higher homology between avian and human beta-1 receptors (69%) compared to that between human beta-1 and beta-2 subtypes (54%) suggests that receptor subtype divergence preceded species divergence .

What are the challenges in studying ADRB1 signaling complexes and how can they be addressed?

Studying ADRB1 signaling complexes presents several technical challenges that require specialized approaches. GPCRs like ADRB1 form transient, dynamic complexes with numerous proteins including G proteins, arrestins, kinases, and scaffolding proteins. These interactions are often of moderate affinity and can be disrupted during isolation attempts. Traditional co-immunoprecipitation may fail to capture the full complexity of these dynamic signaling complexes or may detect only the strongest interactions.

Researchers can address these challenges through multifaceted approaches. Proximity-based labeling techniques such as BioID or APEX can identify proteins in close proximity to ADRB1 in living cells, capturing transient interactions. Crosslinking mass spectrometry can stabilize transient complexes before isolation, allowing identification of interaction interfaces. Single-molecule imaging techniques provide insight into the dynamics of complex formation and dissociation in real-time within cellular environments.

ADRB1 is known to interact with several PDZ domain-containing proteins including MAGI2, MAGI3, Dlg4, and Dlg1 . Studying these interactions requires careful consideration of the cellular context, as expression levels and localization of interaction partners may vary between systems. Physiologically relevant expression systems that retain native protein expression levels and subcellular distributions are preferable to overexpression systems that may force non-physiological interactions. For comprehensive analysis of the ADRB1 interactome, complementary approaches including biophysical techniques (surface plasmon resonance, isothermal titration calorimetry), proteomic approaches (quantitative interaction proteomics), and molecular imaging (FRET/BRET) should be combined.

What are the emerging approaches for studying ADRB1 in cellular microdomains and their significance for signaling specificity?

Emerging approaches for studying ADRB1 in cellular microdomains focus on visualizing, quantifying, and manipulating receptor distribution and activity with unprecedented spatial resolution. Super-resolution microscopy techniques including STORM, PALM, and STED allow visualization of ADRB1 distribution relative to signaling partners and membrane structures at nanoscale resolution. These techniques have revealed that GPCRs like ADRB1 are not uniformly distributed throughout the plasma membrane but cluster in specific microdomains that can influence signaling outcomes.

FRET-based biosensors with subcellular targeting motifs enable measurement of cAMP production or PKA activation in specific cellular compartments, revealing that ADRB1 signaling may be spatially restricted rather than uniform throughout the cell. Optogenetic approaches using light-controlled receptor activation or inhibition can precisely control ADRB1 activity in specific subcellular regions, allowing researchers to examine how signaling from different cellular locations affects downstream responses.

The significance of microdomain-specific signaling lies in explaining the specificity of ADRB1 responses despite sharing common G-protein effectors with other receptors. Physiological responses to ADRB1 activation depend not only on which signaling pathways are triggered but also where within the cell these signals originate. In polarized cells like cardiomyocytes, ADRB1 localization to specific membrane domains (such as T-tubules versus surface sarcolemma) may direct signaling to distinct effector pools. Pathological conditions may disrupt these spatial arrangements, contributing to altered signaling profiles observed in diseases like heart failure. Understanding these spatial aspects of ADRB1 signaling represents a frontier in receptor biology that bridges molecular mechanisms with integrated cellular responses.

What are the common challenges in expressing and purifying functional ADRB1, and how can they be overcome?

Expressing and purifying functional ADRB1 presents several technical challenges common to membrane proteins. First, overexpression often leads to misfolding and aggregation, especially in bacterial systems lacking the sophisticated folding machinery of eukaryotic cells. To address this, researchers can optimize expression conditions by reducing induction temperature (typically to 16-18°C), using weaker promoters, or employing specialized E. coli strains designed for membrane protein expression.

Detergent selection for membrane protein extraction represents another critical challenge. The choice of detergent must balance efficient extraction with preservation of native structure and function. For ADRB1, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin often provide a good starting point. Screening multiple detergents or detergent mixtures may be necessary to identify optimal conditions for a specific experimental application.

Purification of homogeneous, functional receptor typically requires multiple chromatography steps. Affinity purification using the N-terminal 10xHis-tag present in recombinant Xenopus laevis ADRB1 provides an efficient first step, but may need to be followed by size exclusion chromatography to separate monomeric receptor from aggregates. Throughout the purification process, maintaining receptor stability is crucial and may require inclusion of stabilizing ligands (antagonists often provide better stabilization than agonists) and cholesterol or cholesterol analogs in the buffer systems.

Post-purification validation of receptor functionality is essential and can be accomplished through ligand binding assays, thermal stability assessments, or reconstitution into artificial membrane systems for functional studies. For applications requiring long-term stability, researchers should consider formulation with stabilizing excipients or conversion to more stable formats such as nanodiscs or reconstitution into liposomes.

How can researchers address the challenges of studying ADRB1 in native versus heterologous expression systems?

Researchers face significant tradeoffs when choosing between native and heterologous expression systems for ADRB1 studies. Native systems preserve physiological expression levels, proper post-translational modifications, and natural complements of signaling partners, but often present challenges in isolating receptor-specific effects due to expression of multiple receptor subtypes and limited experimental manipulation capabilities. Heterologous systems offer greater experimental control but may lack critical components of the native signaling machinery.

This challenge can be addressed through complementary approaches. For studies in native systems such as cardiac tissue where ADRB1 is naturally expressed, researchers can use subtype-selective ligands to isolate ADRB1-specific responses or employ genetic approaches (knockout or knockdown) to reduce expression of other adrenergic receptor subtypes. Single-cell approaches can help account for cellular heterogeneity within native tissues.

For heterologous expression, several strategies can improve physiological relevance. Co-expression of key signaling partners (G proteins, GRKs, arrestins) alongside ADRB1 can reconstitute essential aspects of the native signaling environment. Using cell lines derived from relevant tissues (such as HL-1 cardiomyocytes for cardiac ADRB1 studies) provides a more appropriate cellular background than generic expression hosts. Controlling expression levels to match physiological ranges avoids artifacts associated with gross overexpression.

Emerging approaches include the development of engineered cell lines with CRISPR-modified endogenous ADRB1 (tagged or modified without overexpression) and the use of induced pluripotent stem cells differentiated into relevant cell types. These systems bridge the gap between native and heterologous approaches by providing both experimental tractability and physiological relevance.

What are the applications of recombinant Xenopus laevis ADRB1 in drug discovery and pharmacological research?

Recombinant Xenopus laevis ADRB1 serves as a valuable tool in drug discovery and pharmacological research through multiple applications. Purified receptor preparations can be used in high-throughput screening assays to identify novel ligands with specific pharmacological properties (agonists, antagonists, or biased ligands). The use of an evolutionarily distinct receptor ortholog like Xenopus ADRB1 alongside mammalian counterparts can help distinguish conserved binding sites that may represent core functional domains from species-specific features.

Structural biology applications represent another significant research area. Purified Xenopus ADRB1 can be used for crystallization trials or cryo-electron microscopy studies to determine three-dimensional structures, potentially revealing unique conformational states compared to mammalian receptors. These structural insights can inform structure-based drug design efforts targeting beta-adrenergic receptors.

Comparative pharmacology studies between amphibian and mammalian ADRB1 can identify evolutionary conservation or divergence in ligand recognition and signaling mechanisms. Such studies may reveal natural variations in receptor properties that could inspire novel therapeutic approaches or identify previously unrecognized ligand binding sites. The Xenopus receptor can be particularly valuable for studying the effects of genetic variations, as mutations corresponding to human polymorphisms can be introduced and their functional consequences assessed in a different evolutionary background.

Additionally, recombinant Xenopus ADRB1 can serve as an immunogen for antibody development when mammalian receptor antigens present challenges. The evolutionary distance may enhance immunogenicity while maintaining sufficient structural similarity for cross-reactivity with mammalian receptors, potentially resulting in antibodies with unique binding properties.

What emerging technologies are advancing our understanding of ADRB1 structure, dynamics, and function?

Several cutting-edge technologies are revolutionizing our understanding of ADRB1 biology. Cryo-electron microscopy has emerged as a powerful approach for determining structures of GPCRs in different conformational states without the need for crystallization. This technique has the potential to capture multiple ADRB1 conformations including inactive, active, and intermediate states, providing unprecedented insights into the mechanisms of receptor activation and the structural basis of biased signaling.

Single-molecule fluorescence approaches allow direct visualization of ADRB1 conformational changes, dimerization events, and interactions with signaling partners in real-time. These techniques can reveal the kinetics and dynamics of receptor state transitions that are masked in ensemble measurements, providing insights into signaling mechanisms at the molecular level.

Nanobody-based biosensors that recognize specific conformational states of GPCRs represent another innovative approach. These can be used to stabilize particular receptor conformations for structural studies or as biosensors to detect receptor activation states within living cells. When combined with genetic code expansion for site-specific incorporation of fluorescent amino acids, these approaches enable precise monitoring of local conformational changes within the receptor structure.

Advances in computational methods, particularly molecular dynamics simulations with enhanced sampling techniques, now allow simulation of receptor dynamics on physiologically relevant timescales. These computational approaches can reveal transition pathways between different receptor states and identify cryptic binding sites not evident in static structures. Integration of experimental data with computational models through approaches like Markov state modeling provides a comprehensive view of the complex energy landscape governing receptor function.

CRISPR-based genome engineering enables precise modification of endogenous ADRB1 in cellular and animal models, allowing studies of receptor function in physiologically relevant contexts without the artifacts associated with overexpression systems. This approach is particularly valuable for studying the effects of disease-associated mutations or polymorphisms within the native genomic context.

How has ADRB1 structure and function evolved across species, and what insights does the Xenopus ortholog provide?

Evolutionary analysis of ADRB1 across species reveals both conservation of core functional elements and divergence in regulatory domains. Phylogenetic studies indicate that the human beta-1 adrenergic receptor shares 69% homology with the avian beta AR but only 54% homology with the human beta-2 adrenergic receptor . This pattern suggests that the divergence of receptor subtypes preceded the divergence of vertebrate species, with subtype-specific functions being conserved through evolution.

Evolutionary conservation analysis identifies the transmembrane domains and ligand binding pocket as the most highly conserved regions, reflecting their critical role in receptor function. In contrast, the third intracellular loop and C-terminal domains show greater divergence, consistent with their roles in interactions with more rapidly evolving cytoplasmic signaling partners. The N-terminal domain, important for receptor expression and dimerization, shows intermediate conservation with retention of key glycosylation sites across species .

This evolutionary perspective provides context for interpreting human receptor polymorphisms. Sites that are highly conserved across diverse species are likely to be functionally critical, and polymorphisms at these positions may have more significant physiological consequences than variations at less conserved sites. The Xenopus ortholog thus serves as a valuable reference point in a broader evolutionary context for understanding structure-function relationships in adrenergic receptors.

What can we learn from comparing beta-adrenergic receptor subtypes across species?

Comparative analysis of beta-adrenergic receptor subtypes across species provides profound insights into receptor evolution, functional specialization, and fundamental mechanisms of GPCR signaling. Studies have revealed that beta-1 and beta-2 adrenergic receptors are products of distinct genes that likely arose from an ancient gene duplication event . The greater sequence similarity between the same receptor subtype across different species (69% homology between human and avian beta-1 receptors) than between different subtypes within the same species (54% homology between human beta-1 and beta-2 receptors) suggests strong evolutionary pressure to maintain subtype-specific functions .

This comparative approach identifies conserved structural motifs critical for core functions versus divergent regions that confer subtype-specific properties. The transmembrane spanning region IV appears particularly important for receptor subtype specificity , while the third intracellular loop, especially a proline-rich region of 24 amino acids, influences the efficiency of G-protein coupling . The C-terminal domain determines subtype-specific desensitization patterns when expressed in cellular models .

From a pharmacological perspective, cross-species comparisons help distinguish universal aspects of beta-adrenergic pharmacology from species-specific idiosyncrasies. This knowledge is critical for translating findings from model organisms to human applications. Xenopus laevis, positioned evolutionarily between fish and mammals, provides a particularly valuable comparative model. The observation that Xenopus ADRB1 maintains beta-1 specific pharmacological responses when expressed in oocytes suggests conservation of the fundamental ligand recognition mechanisms despite substantial evolutionary distance.

At a broader level, comparing receptor properties across species provides insight into how signaling systems adapt to different physiological demands. Differences in cardiovascular physiology, metabolic regulation, and stress responses across species may be reflected in subtle variations in receptor structure, expression patterns, or signaling pathways. These natural variations represent evolutionary experiments that can inspire novel approaches to therapeutic intervention in human disease.

How does ADRB1 integrate into broader signaling networks and what are the implications for physiological responses?

ADRB1 functions as a node within complex signaling networks rather than operating in isolation. Pathway analysis reveals that ADRB1 participates in multiple signaling cascades including adrenergic signaling in cardiomyocytes, general adrenoceptor pathways, amine ligand-binding receptors, calcium signaling, and endocytosis . This network integration allows for coordinated responses to sympathetic stimulation across multiple cellular processes and tissue types.

The integration of ADRB1 into these networks occurs through both direct protein-protein interactions and downstream signaling convergence. ADRB1 directly interacts with numerous proteins including MAGI2, MAGI3, Dlg4, GPRASP1, Dlg1, GPRASP2, MAGI1, GOPC, and Gipc1 . These interactions influence receptor localization, trafficking, and signaling specificity. Interestingly, many of these interacting proteins contain PDZ domains, consistent with ADRB1's PDZ domain binding capability .

At the systems level, ADRB1 signaling intersects with other pathways through shared downstream effectors and second messengers. For example, in the calcium signaling pathway, ADRB1 activation influences calcium dynamics alongside other receptors such as HTR2C, ADORA2A, and F2R . This pathway convergence allows for integration of multiple inputs and context-dependent modulation of cellular responses. In adrenergic signaling in cardiomyocytes, ADRB1 functions alongside components like MAPK14, RPS6KA5, and CACNG1A to regulate contractility, metabolism, and gene expression .

The physiological implications of this network integration are significant. It enables cell type-specific responses to the same hormonal stimulus (epinephrine or norepinephrine) based on the complement of interacting proteins and downstream effectors expressed in each cell type. It also creates multiple levels of regulation and opportunities for cross-talk between signaling systems. Disruption of these networks through genetic variations, altered expression of interacting proteins, or pathological conditions can lead to dysregulated signaling and contribute to diseases such as heart failure, where beta-adrenergic signaling is profoundly altered.

What methodological approaches are most effective for studying ADRB1 in the context of systems biology?

Studying ADRB1 within a systems biology framework requires integrative approaches that capture the complexity of receptor-mediated networks across multiple scales. Proteomics-based methods provide a foundation for mapping the ADRB1 interactome in different cellular contexts. Affinity purification coupled with mass spectrometry can identify proteins that interact with ADRB1 either directly or as part of multiprotein complexes. Proximity labeling approaches such as BioID or APEX provide complementary information by identifying proteins in the vicinity of ADRB1 in living cells, potentially capturing transient interactions missed by traditional co-immunoprecipitation.

Phosphoproteomics represents another powerful approach for tracing ADRB1 signaling networks. By quantifying changes in protein phosphorylation following receptor activation, researchers can map the spread of the signal through downstream kinase cascades. This approach has identified numerous proteins whose phosphorylation state changes following beta-adrenergic stimulation, revealing unexpected connections to pathways beyond the canonical cAMP-PKA axis.

Multi-omics integration provides a comprehensive view of ADRB1-mediated cellular responses. By combining data from transcriptomics, proteomics, phosphoproteomics, and metabolomics analyses following receptor activation, researchers can trace how the initial signal propagates through various molecular layers to ultimately affect cellular function. Computational modeling approaches, including ordinary differential equation-based models and logic-based models, can integrate experimental data into predictive frameworks that capture the dynamics of ADRB1 signaling networks.

Network pharmacology approaches examine how drugs targeting ADRB1 affect broader signaling networks, potentially explaining therapeutic effects and side effects. This systems-level perspective on drug action can guide the development of more selective or context-specific therapeutic strategies. Finally, single-cell approaches are increasingly important for understanding heterogeneity in ADRB1 expression and signaling responses within tissues. Single-cell transcriptomics or mass cytometry can reveal distinct cell populations with different receptor expression levels or signaling capabilities, providing insight into the cellular basis of variable responses to adrenergic stimulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.