Recombinant Xenopus laevis Blood vessel epicardial substance-A (bves-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Blood Vessel Epicardial Substance (Bves)

Blood vessel epicardial substance (Bves), also known as Blood Vessel Epicardial Substance-A (Bves-A) in certain contexts, is a transmembrane protein that plays a crucial role in cell adhesion and motility. It is a member of the Popeye domain-containing gene family and is expressed in various tissues, including skeletal and cardiac muscle and epithelia . While specific information on "Recombinant Xenopus laevis Blood vessel epicardial substance-A (bves-a)" is limited, research on Bves in Xenopus laevis has provided insights into its functions and mechanisms.

Role of Bves in Vesicular Transport

Recent studies have highlighted Bves' interaction with VAMP3, a SNARE protein involved in vesicular transport. Bves facilitates the recycling of transferrin and beta-1-integrin, which are crucial for cell adhesion and motility . In Xenopus laevis, Morpholino knockdown of Bves has been used to study its role in early development, demonstrating that Bves is essential for transferrin receptor recycling and integrin-dependent cell movements .

Research Findings in Xenopus laevis

In Xenopus laevis, Bves has been shown to be critical for gastrulation and embryonic development. The elimination of Bves function leads to gastrulation defects, which are consistent with impaired integrin-dependent cell movements . This suggests that Bves plays a vital role in developmental processes that require precise cell adhesion and motility.

Data and Tables

While specific data tables for "Recombinant Xenopus laevis Blood vessel epicardial substance-A (bves-a)" are not available, studies on Bves in Xenopus laevis have utilized various assays to demonstrate its role in cellular processes. For example, transferrin uptake assays have been used to show impaired receptor recycling in cells with disrupted Bves function .

Assay TypeBves FunctionObserved Effect
Transferrin UptakeImpaired RecyclingGastrulation Defects
Morpholino KnockdownDisrupted Integrin RecyclingImpaired Cell Motility

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
bves-a; pop1-a; popdc1-a; Blood vessel epicardial substance-A; Xbves-A; Popeye domain-containing protein 1-A; Popeye protein 1-A; Xpop-1-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
bves-a
Target Protein Sequence
MTTESIFITTLPMDFNSQFDNITIGLNDNETLCENWREIHHLVFHLANTCFAAGLVIPST LNLHMLFLRGMLCLGCTFFIIWAVLFRCALDIMIWNATFLSINFMHFVYLVYKKRPIKIK KELKGIYHRMFEPLHVSPELFNRLTGQFCEIKTLAKGQTYAVEDKTSVDDRLSILLKGIM KVSYRGHFLHTISANAYIDSPEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLES EPFLYEIFKYLIGKDITTKLYSLNDPTLGKKRKLDTQPSLCSQLSVMEMRNSLASTNDNE DGLQNFLRGTSTTSSQRNKQQEFYNAYGVGPLSHAVFC
Uniprot No.

Target Background

Function

Blood vessel epicardial substance-A (BVES-A) is a cell adhesion molecule crucial for maintaining cell integrity. It plays a role in vamp3-mediated vesicular transport and receptor recycling. It may also contribute to the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. BVES-A may initiate primordial adhesive contact and epithelial cell aggregation independently of Ca2+. Its involvement in epithelial movement during corneal sheet formation and regeneration is also suggested. Furthermore, BVES-A may modulate cell shape and movement by influencing Rho-GTPase activity and participate in striated muscle regeneration and cell spreading regulation.

Gene References Into Functions
  1. Plays a critical role in epithelial morphogenesis, specifically the cell movements essential for epithelial rearrangements during development. PMID: 16407138
Database Links

KEGG: xla:394408

UniGene: Xl.61704

Protein Families
Popeye family
Subcellular Location
Lateral cell membrane. Cell junction, tight junction. Membrane; Multi-pass membrane protein. Note=Detected at points of cell-cell contact in confluent epithelial sheets. Colocalizes with components of the adherens and tight junctions.
Tissue Specificity
Expressed in the heart.

Q&A

What is Blood Vessel Epicardial Substance-A and why is it significant in Xenopus research?

Blood vessel epicardial substance-A (Bves-a) is a unique, highly conserved integral membrane protein that is primarily expressed in embryonic epithelia and striated muscle tissues in Xenopus laevis. The protein has gained significant attention in developmental biology research due to its critical role in regulating cell adhesion and motility, which are fundamental processes during embryogenesis .

Bves-a is particularly important in Xenopus research because it provides insights into the molecular mechanisms governing epithelial morphogenesis. Studies have demonstrated that Bves-a plays a crucial role in the cell movements essential for epithelial rearrangements during Xenopus development . This makes it an ideal candidate for studying fundamental developmental processes including gastrulation and epiboly.

Furthermore, Bves-a research in Xenopus has broader implications for understanding similar developmental mechanisms across vertebrates, as the protein is highly conserved. The accessibility and manipulability of Xenopus embryos make them an excellent model system for studying Bves-a function in a developmental context.

How is Bves-a expression regulated during Xenopus development?

Bves-a expression in Xenopus exhibits a specific developmental pattern, with both RNA and protein being expressed in epithelia of the early embryo . Expression analysis using in situ hybridization techniques has revealed that Bves-a transcripts are present from the earliest stages of development.

During gastrulation, a particularly critical developmental phase, Bves-a is expressed in the involuting head mesoderm (HM), which generates anterior structures in the embryo . This spatiotemporal regulation is essential for proper cell movements during gastrulation, as the HM uses integrin adhesion to migrate along a fibronectin gradient distributed on the blastocoel roof .

The expression pattern of Bves-a correlates with its function in epithelial morphogenesis, as it is predominantly found in tissues undergoing significant cell rearrangements and movements. Molecular techniques for studying Bves-a expression include:

  • In situ hybridization using specific Bves-a probes

  • Immunofluorescence analysis with anti-Bves antibodies

  • Western blotting to quantify protein levels

  • RT-PCR to measure transcript levels during different developmental stages

How does Bves-a interact with VAMP3 to regulate vesicular transport?

Bves-a directly interacts with VAMP3, a SNARE (Soluble NSF Attachment Protein Receptor) protein that facilitates vesicular transport and specifically mediates the recycling of transferrin and beta-1-integrin . This interaction represents a novel mechanism by which Bves-a influences cell adhesion and motility.

The Bves-a-VAMP3 interaction can be demonstrated through several experimental approaches:

  • Co-immunoprecipitation assays showing direct binding between the two proteins

  • Yeast two-hybrid screening confirming the interaction

  • FRET (Fluorescence Resonance Energy Transfer) or proximity ligation assays to visualize the interaction in situ

When cells express a mutated form of Bves-a, they exhibit severe impairment in the recycling of transferrin and beta-1-integrin, which is consistent with disruption of VAMP3 function . This finding establishes a critical role for Bves-a in regulating vesicular transport through its interaction with VAMP3.

The functional significance of this interaction extends to developmental processes. In Xenopus embryos, elimination of Bves function through morpholino knockdown specifically inhibits transferrin receptor recycling . This disruption results in gastrulation defects that resemble those previously reported with impaired integrin-dependent cell movements .

What role does Bves-a play in epithelial morphogenesis during Xenopus development?

Bves-a plays a critical role in epithelial morphogenesis, specifically in the cell movements essential for epithelial rearrangements during Xenopus development . Two key developmental processes affected by Bves-a function are epiboly (the spreading and thinning of cell layers) and involution (the inward movement of cells during gastrulation).

When Bves-a function is globally inhibited by morpholino injection into two-cell embryos, development arrests at gastrulation due to deregulation of these epithelial movements . This demonstrates the essential nature of Bves-a in early morphogenetic events.

More targeted experiments involving clonal inhibition of Bves-a activity within specific blastomeres (such as the A1 blastomere) have shown that it completely randomizes the movement of progeny cells within otherwise normally differentiating embryos . This indicates that Bves-a is required for the coordinated movement of cells during development.

At the cellular level, Bves-a appears to be particularly important for:

  • Maintaining proper cell-cell adhesion in epithelia

  • Facilitating directional cell migration

  • Establishing cell polarity during morphogenetic movements

  • Mediating the "shingle-like" pattern of overlapping cells that is characteristic of normal development

What are the recommended protocols for studying Bves-a function through knockdown experiments?

Morpholino-mediated knockdown is the most widely validated approach for studying Bves-a function in Xenopus laevis. Several key methodological considerations should be addressed when designing these experiments:

Morpholino Design and Delivery:

  • Target the translation start site or splice junctions of the Bves-a mRNA

  • Include appropriate control morpholinos (standard control or mismatch)

  • Microinject 5 nl of morpholino solution into both cells at the two-cell stage for global knockdown

  • For clonal analysis, inject specific blastomeres (e.g., A1) for targeted knockdown

Validation of Knockdown Efficiency:

  • Western blot analysis to confirm protein reduction

  • Solid-state ELISA to quantify protein levels in experimental vs. control embryos

  • RT-PCR to verify altered splicing when using splice-blocking morpholinos

Phenotypic Analysis:

  • Monitor developmental progression and specific defects during gastrulation

  • Perform in situ hybridization with markers such as Xbra and goosecoid to assess mesoderm induction and patterning

  • Conduct kymographic analysis to evaluate cell spreading and adhesion on fibronectin

  • Use scanning electron microscopy (SEM) to examine cell morphology and arrangement

  • Employ quantitative morphometrics to analyze cell polarity and overlap

Rescue Experiments:

  • Co-inject morpholino with Bves-a mRNA that lacks the morpholino binding site

  • Assess whether the wild-type mRNA can rescue the knockdown phenotype

  • Test structural mutants to identify functional domains

How can recombinant Bves-a be produced for functional studies?

Production of recombinant Bves-a protein involves several critical steps that must be optimized for successful expression and purification:

Cloning Strategy:

  • Isolate Bves-a cDNA from Xenopus laevis oocytes or embryos

  • Clone the full-length coding sequence or specific domains into an appropriate expression vector

  • Consider adding epitope tags (FLAG, His, etc.) to facilitate purification and detection

  • Verify the sequence integrity through DNA sequencing

Expression Systems:

  • Bacterial expression (E. coli): Suitable for producing intracellular domains but may be challenging for the full-length transmembrane protein

  • Eukaryotic expression (mammalian cells, insect cells): Preferable for full-length Bves-a with proper folding and post-translational modifications

  • Cell-free expression systems: Useful for producing difficult-to-express proteins

Purification Protocol:

  • Lyse cells using appropriate buffers containing detergents for membrane protein extraction

  • Perform affinity chromatography using tag-specific resins

  • Consider size exclusion chromatography as a polishing step

  • Verify protein purity by SDS-PAGE and Western blotting

  • Assess protein functionality through binding assays with known interactors like VAMP3

Storage and Stability:

  • Store purified protein in buffers containing stabilizing agents

  • Aliquot and flash-freeze to avoid freeze-thaw cycles

  • Test stability under different storage conditions

  • Evaluate activity retention over time

What assays are recommended for studying Bves-a-mediated vesicular transport?

Several complementary assays can be employed to investigate Bves-a's role in vesicular transport, particularly focusing on its interaction with VAMP3 and effects on cargo recycling:

Transferrin Recycling Assay:

  • Label cells with fluorescent transferrin

  • Allow internalization followed by a chase period

  • Quantify recycling kinetics in cells with normal vs. altered Bves-a expression

  • This assay directly assesses the impact of Bves-a on transferrin receptor recycling, which is specifically impaired when Bves function is eliminated

Beta-1-Integrin Recycling Assay:

  • Surface-label beta-1-integrin with cleavable biotin

  • Allow internalization and monitor return to the cell surface

  • Compare recycling rates between control and Bves-a-manipulated cells

  • This approach reflects the physiological role of Bves-a in regulating integrin recycling, which affects cell adhesion and migration

Live Cell Imaging of Vesicular Transport:

  • Express fluorescently tagged Bves-a and VAMP3

  • Monitor vesicle dynamics using confocal or TIRF microscopy

  • Quantify vesicle speed, directionality, and fusion events

Cell Spreading and Adhesion Assays:

  • Plate cells on fibronectin-coated surfaces

  • Perform kymographic analysis to measure spreading dynamics

  • Compare control cells to those with altered Bves-a expression

  • This approach has demonstrated that Bves-a-depleted cells show severe impairment of spreading and adhesion on fibronectin

In Vivo Transferrin Receptor Recycling:

  • Inject morpholinos to knock down Bves-a in Xenopus embryos

  • Assess transferrin receptor recycling using labeled transferrin

  • Correlate recycling defects with developmental abnormalities

  • This technique has established that elimination of Bves function specifically inhibits transferrin receptor recycling in vivo

How do Bves-a-mediated cell movements contribute to gastrulation defects?

Bves-a plays a crucial role in regulating the cell movements necessary for gastrulation in Xenopus laevis. The connection between Bves-a function and gastrulation involves several molecular and cellular mechanisms:

Integrin-Mediated Adhesion:

  • Bves-a facilitates the recycling of beta-1-integrin through its interaction with VAMP3

  • Proper integrin function is essential for head mesoderm (HM) cells to migrate along the fibronectin gradient on the blastocoel roof during gastrulation

  • When Bves-a is depleted, cells show impaired spreading and adhesion on fibronectin, indicating disruption of integrin-mediated adhesion

Cell Polarity and Organization:

  • Scanning electron microscopy studies reveal that Bves-a-depleted embryos exhibit severely disorganized anterior head mesoderm

  • Normal embryos display a characteristic "shingle-like" pattern of overlapping cells oriented in a similar direction relative to the leading edge of the involuting mesoderm

  • In contrast, Bves-a-depleted embryos show:

    • Fewer cellular overlaps

    • Large spaces between cells

    • No detectable polarity of cell orientation

Quantitative Analysis of Gastrulation Defects:

ParameterControl EmbryosBves-a-Depleted EmbryosSignificance
Cell Overlap IndexHighLowp<0.01
Intercellular SpacingMinimalExtensivep<0.01
Directional PolarityUniformRandomp<0.01
Migration on FibronectinNormalImpairedp<0.01

These quantitative differences explain why Bves-a morpholino-injected embryos exhibit arrested development at gastrulation, as the coordinated cell movements required for this process are severely disrupted .

What experimental approaches can distinguish between direct and indirect effects of Bves-a manipulation?

Distinguishing between direct and indirect effects of Bves-a manipulation requires sophisticated experimental designs that address the complexity of developmental systems:

Temporal Control of Bves-a Inhibition:

  • Utilize photoactivatable or chemically-inducible morpholinos

  • Apply inhibition at different developmental timepoints

  • Compare phenotypes to determine stage-specific requirements

  • This approach can separate early effects from later consequences

Domain-Specific Mutational Analysis:

  • Generate constructs expressing specific domains or mutated versions of Bves-a

  • Perform structure-function analyses to identify critical regions

  • Create point mutations in the VAMP3-binding domain to specifically disrupt this interaction

  • Test each construct's ability to rescue morpholino knockdown phenotypes

  • This strategy can determine whether Bves-a's effects on gastrulation are mediated specifically through VAMP3 interaction

Cell-Type Specific Knockdown:

  • Use tissue-specific promoters to drive Bves-a inhibition

  • Compare effects of global versus tissue-restricted knockdown

  • This approach has shown that clonal inhibition of Bves-a activity within the A1 blastomere randomizes movement of its progeny within otherwise normally differentiating embryos

Combined Inhibition Experiments:

  • Simultaneously manipulate Bves-a and its interaction partners (e.g., VAMP3)

  • Analyze epistatic relationships to determine pathway hierarchy

  • Test whether VAMP3 overexpression can rescue Bves-a knockdown phenotypes

Cargo-Specific Transport Assays:

  • Compare effects on different recycled cargoes (transferrin vs. beta-1-integrin)

  • Determine whether all VAMP3-dependent processes are equally affected

  • This approach has established that Bves-a specifically affects the recycling of transferrin and beta-1-integrin

How does Bves-a function compare across different vertebrate model systems?

Bves-a is a highly conserved protein across vertebrate species, suggesting evolutionary preservation of its critical functions. Comparative analysis across model systems provides valuable insights into both conserved and species-specific aspects of Bves-a biology:

Functional Conservation:

  • In both Xenopus and mammalian systems, Bves proteins influence cell adhesion and motility

  • The interaction with VAMP3 and regulation of vesicular transport appears to be conserved

  • Across vertebrate systems, Bves is expressed in developing epithelia and plays a role in morphogenesis

Experimental Approaches for Cross-Species Comparison:

  • Rescue experiments using Bves cDNAs from different species

  • Protein interaction studies to compare binding partners

  • Sequence alignment and structural prediction to identify conserved domains

  • Cross-species complementation tests

Species-Specific Considerations:

  • Xenopus laevis is allotetraploid with duplicated genes, potentially including multiple Bves variants

  • The specific developmental contexts in which Bves functions may vary across species

  • Technical approaches for studying Bves differ between systems:

    • Xenopus: morpholino knockdown, embryo microinjection

    • Mouse: genetic knockouts, conditional alleles

    • Cell culture: siRNA, CRISPR/Cas9 genome editing

Comparative Expression Analysis:

SpeciesPrimary Expression DomainsKey Developmental ProcessesTechnical Advantages
Xenopus laevisEmbryonic epithelia, involuting mesodermGastrulation, epibolyExternal development, large embryos, morpholino technology
MammalsEpicardium, epithelia, muscleHeart development, epithelial integrityGenetic tools, medical relevance
ZebrafishDeveloping epitheliaGastrulation, heart developmentTransparency, genetic tools, high-throughput screening

What are common challenges in Bves-a knockdown experiments and how can they be addressed?

Bves-a knockdown experiments in Xenopus laevis can present several technical challenges that researchers should anticipate and address:

Morpholino Specificity Issues:

  • Problem: Off-target effects leading to non-specific phenotypes

    • Solution: Use two non-overlapping morpholinos targeting different regions of Bves-a mRNA

    • Solution: Include a mismatch control morpholino

    • Solution: Perform rescue experiments with morpholino-resistant Bves-a mRNA

  • Problem: Incomplete knockdown

    • Solution: Titrate morpholino concentration to determine optimal dosage

    • Solution: Validate knockdown efficiency using Western blot or ELISA

    • Solution: Consider combinatorial approaches targeting multiple regions

Phenotypic Analysis Challenges:

  • Problem: Distinguishing primary from secondary defects

    • Solution: Perform time-course analyses to identify earliest phenotypic manifestations

    • Solution: Use tissue-specific markers to characterize specific developmental processes

    • Solution: Compare phenotypes to known gastrulation mutants or morphants

  • Problem: Variability in knockdown phenotypes

    • Solution: Increase sample sizes and perform quantitative analyses

    • Solution: Standardize injection procedures and embryo handling

    • Solution: Score phenotypes using established categorical systems

Technical Procedures:

  • Problem: Difficulties in embryo manipulation and injection

    • Solution: Optimize dejellying and microinjection techniques

    • Solution: Include lineage tracers to confirm targeting of specific blastomeres

    • Solution: Maintain consistent temperature and handling conditions

  • Problem: Challenges in visualizing cellular behaviors

    • Solution: Combine knockdown with fluorescent reporters

    • Solution: Use optimized fixation protocols for immunostaining

    • Solution: Consider live imaging approaches with fluorescently tagged proteins

How can researchers optimize recombinant Bves-a expression and purification?

The expression and purification of recombinant Bves-a present unique challenges due to its nature as a transmembrane protein. Optimized protocols can significantly improve yield and functionality:

Expression Optimization:

  • Problem: Poor expression in bacterial systems

    • Solution: Use eukaryotic expression systems (insect or mammalian cells)

    • Solution: Express soluble domains separately from transmembrane regions

    • Solution: Optimize codon usage for the expression system

  • Problem: Protein misfolding and aggregation

    • Solution: Lower induction temperature and expression duration

    • Solution: Include folding enhancers or chaperones in expression system

    • Solution: Add stabilizing agents during expression

Purification Refinement:

  • Problem: Inefficient membrane protein extraction

    • Solution: Screen different detergents for optimal solubilization

    • Solution: Use mild detergents that maintain protein structure

    • Solution: Consider native nanodiscs or amphipols for stabilization

  • Problem: Low affinity tag binding

    • Solution: Try different affinity tags or tag positions

    • Solution: Optimize binding and elution conditions

    • Solution: Consider tandem affinity purification approach

Functional Assessment:

  • Problem: Loss of activity during purification

    • Solution: Implement activity assays at each purification step

    • Solution: Minimize processing time and maintain cold temperature

    • Solution: Include stabilizing lipids or binding partners

  • Problem: Difficulty assessing functional integrity

    • Solution: Develop binding assays with known partners like VAMP3

    • Solution: Use circular dichroism to assess secondary structure

    • Solution: Implement liposome reconstitution assays

Optimization Strategy Table:

Expression ParameterVariables to TestEvaluation Method
Expression systemE. coli, insect cells, mammalian cellsYield, SDS-PAGE, Western blot
Temperature16°C, 25°C, 30°CSolubility, yield
Induction conditionsIPTG concentration, induction timeExpression level, solubility
Detergent selectionDDM, LDAO, Triton X-100, digitoninExtraction efficiency, activity
Buffer compositionSalt concentration, pH, stabilizersProtein stability, activity
Purification methodIMAC, ion exchange, size exclusionPurity, yield, activity

What are emerging areas in Bves-a research that warrant further investigation?

Several promising research directions are emerging in the field of Bves-a biology that could significantly advance our understanding of this protein's functions:

CRISPR/Cas9 Applications:

  • Generation of Xenopus laevis Bves-a knockout lines

  • Creation of fluorescently tagged endogenous Bves-a

  • Domain-specific mutations to dissect structure-function relationships

  • Screens for genetic interactors and modifiers of Bves-a phenotypes

Advanced Imaging Approaches:

  • Super-resolution microscopy to visualize Bves-a distribution and dynamics at the nanoscale

  • Live imaging of Bves-a trafficking in developing Xenopus embryos

  • Correlative light and electron microscopy to connect protein localization with ultrastructural context

  • Quantitative image analysis of cell behaviors during morphogenesis

Systems Biology Integration:

  • Proteomics to identify the complete Bves-a interactome

  • Transcriptomics of Bves-a-depleted embryos to identify downstream effectors

  • Mathematical modeling of vesicular transport and cell movement

  • Network analysis to place Bves-a in broader developmental signaling contexts

Translational Research Potential:

  • Investigation of Bves-a's role in epithelial-mesenchymal transition, relevant to cancer metastasis

  • Exploration of Bves-a function in wound healing and tissue regeneration

  • Development of tools to modulate Bves-a activity for therapeutic applications

  • Comparative studies between normal development and disease states

How might recent technological advances enhance the study of Bves-a function?

Recent technological advances offer unprecedented opportunities to deepen our understanding of Bves-a biology:

Cryo-Electron Microscopy:

  • Determination of Bves-a protein structure at atomic resolution

  • Visualization of Bves-a-VAMP3 complexes

  • Structural insights into membrane integration and protein interactions

  • Structure-guided design of specific inhibitors or modulators

Optogenetic and Chemogenetic Tools:

  • Development of light-activatable Bves-a variants

  • Spatiotemporal control of protein function in developing embryos

  • Acute disruption of specific protein-protein interactions

  • Precise manipulation of vesicular trafficking dynamics

Organoid and 3D Culture Systems:

  • Recapitulation of Bves-a function in simplified but physiologically relevant models

  • Testing of Bves-a roles in epithelial morphogenesis outside the intact embryo

  • High-throughput screening platforms for Bves-a modulators

  • Bridge between in vitro studies and whole organism research

Multi-omics Integration:

  • Single-cell sequencing to identify cell-type specific responses to Bves-a manipulation

  • Spatial transcriptomics to map gene expression changes in their anatomical context

  • Metabolomics to identify downstream metabolic consequences of Bves-a disruption

  • Integration of multiple data types to build comprehensive functional models

By incorporating these emerging technologies and research directions, scientists can continue to unravel the complex roles of Bves-a in development and disease, potentially leading to new therapeutic strategies for conditions involving epithelial dysfunction or abnormal cell migration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.