Recombinant Xenopus laevis C-X-C chemokine receptor type 4-A (cxcr4-a)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant cxcr4-a is produced using diverse expression platforms:

Expression Platforms

  • Escherichia coli: Used for partial-length recombinant cxcr4-a with >85% purity (CSB-EP897408XBE1-B) .

  • Mammalian Cells: Full-length cxcr4-a with His-tag, expressed in CHO-K1 cells (INS-SF-1004-L/MH) .

  • Insect Cells: Baculovirus systems for functional reconstitution with heterotrimeric Gi2 .

Key Assays and Findings

  • GTP[S] Binding: Recombinant cxcr4-a activates Gi2-mediated GTP-binding in insect cell membranes, with efficacy comparable to human CXCR4 .

  • Calcium Mobilization: Induces intracellular calcium release in lymphoblastic cells at nanomolar concentrations .

  • Chemotaxis: Promotes migration of CXCR4-expressing cells toward SDF-1 gradients .

Developmental Roles

  • Neural Crest Migration: cxcr4-a mRNA is expressed in neural crest cells, guiding their migration to the heart anlage .

  • Hematopoiesis: Detected in the dorsal lateral plate, a site of definitive hematopoiesis in Xenopus .

  • Organogenesis: Upregulated during neurulation (stages 14–18) and highly expressed in the CNS, sensory organs, and heart .

Available Products

SupplierProduct CodeExpression LevelLicense
InSCREENexINS-SF-1004-L~400 molecules/cellAcademic/Commercial
Creative BioMartRFL26096XFFull-lengthResearch use
CusabioCSB-EP897408XBE1PartialResearch use

Applications

  • HIV Research: Used to study CXCR4’s role as an HIV co-receptor .

  • Developmental Biology: Tools for analyzing SDF-1/CXCR4 signaling in embryogenesis .

  • Drug Discovery: Screening for CXCR4 antagonists in cancer and autoimmune diseases .

Evolutionary and Functional Conservation

Despite sequence divergence, cxcr4-a retains functional equivalence to mammalian CXCR4:

ParameterXenopus cxcr4-aHuman CXCR4
SDF-1 ActivationFull agonism by human SDF-1Native ligand specificity
Developmental RoleNeural crest/heart guidanceHematopoietic stem cell homing
Receptor CrosstalkInteracts with Gi2Couples with Gi/o proteins

Challenges and Future Directions

  • Structural Studies: Limited crystallographic data on amphibian CXCR4 .

  • In Vivo Models: Role in Xenopus hematopoiesis requires further validation .

  • Therapeutic Potential: Cross-species reactivity supports its use in translational studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request as feasible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
cxcr4-a; cxcr4; C-X-C chemokine receptor type 4-A; CXC-R4-A; CXCR-4-A; xCXCR4; Stromal cell-derived factor 1 receptor A; SDF-1 receptor A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
cxcr4-a
Target Protein Sequence
MDGFSGGIDINIFDGNSTENGSGDFEDFIEPCFMHENSDFNRIFLPTIYSFIFLLGIIGN GLVVVVMGYQKKSRTMTDKYRLHLSVADLLFVFTLPFWSVDAAIGWYFKEFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQGSRKMLADKVVYAGVWLPALLLTVPDLVFAR VSDENGQFVCDRIYPIENRETWTVGFRFLHITVGLILPGLIILICYCVIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVCLTTDTFMLLGLVKGDCIWENTLHMAISITEALAFF HCCLNPILYAFLGAKFKTSAQNAFTSVSRGSSLKILSKKRAGLSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
This protein functions as a receptor for the C-X-C chemokine cxcl12/sdf-1. It transduces signals by elevating intracellular calcium ion levels. Signaling with cxcl12/sdf-1 mediates the directional movement of mesodermal cells during gastrulation. This protein may play a role in the migration of embryonic presumptive primordial germ cells (pPGCs). It might also be involved in regulating the migration of hematopoietic stem cells into the larval liver.
Database Links

KEGG: xla:100192360

UniGene: Xl.548

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Nucleus. Early endosome. Late endosome. Lysosome.
Tissue Specificity
Highly expressed in the embryonic nervous system including forebrain, hindbrain and sensory organs (including eye), and in neural crest cells. Also expressed in the dorsal lateral plate, the first site of definitive hematopoiesis in the embryo. Appears in

Q&A

What is the structural relationship between Xenopus laevis CXCR4 and mammalian CXCR4?

Xenopus laevis CXCR4 (xCXCR4) shares only 42% of its extracellular residues with mammalian CXCR4, yet remarkably maintains functional compatibility with human SDF-1. This conservation suggests critical constraints on structure-function relationships. The relatively low sequence identity primarily affects extracellular domains, while transmembrane and intracellular domains show greater conservation . Of particular significance, only 19 specific residues in the extracellular portions are conserved between Xenopus and mammalian CXCR4, suggesting these amino acids may be crucial for SDF-1 recognition and receptor activation . This conservation pattern provides insights into essential functional motifs that have been maintained throughout vertebrate evolution.

How does Xenopus laevis CXCR4 activity compare to human CXCR4 in ligand binding assays?

Despite significant sequence divergence, functional reconstitution experiments reveal that xCXCR4 is indistinguishable from human CXCR4 in terms of activation by human SDF-1α and SDF-1β . This functional conservation extends to both xSDF-1 and hSDF-1α promoting CXCR4-mediated activation of heterotrimeric Gi2 in cell-free systems and inducing calcium release and chemotaxis in intact lymphoblastic cells . Recombinant xSDF-1, despite being only 64-66% identical to its mammalian counterparts, shows equivalent potency in activating both X. laevis CXCR4 and human CXCR4 . This remarkable functional conservation across species with significant sequence divergence provides a valuable model for studying the essential structural components required for CXCR4 function.

What is the expression pattern of CXCR4 during Xenopus embryonic development?

xCXCR4 mRNA expression is tightly regulated during embryonic development, showing significant upregulation during early neurula stages and maintaining high expression during early organogenesis . Whole mount in situ hybridization analysis reveals abundant expression in specific tissues:

Developmental StagePrimary Expression Locations
NeurulaNervous system primordium
Early organogenesisForebrain, hindbrain, sensory organs
Mid-developmentNeural crest cells
Later stagesDorsal lateral plate (first site of definitive hematopoiesis)

The expression of xCXCR4 appears to be tightly coordinated with its ligand xSDF-1, suggesting synchronized regulation of this signaling system during development . Notably, CXCR4 mRNA appears to be absent from the heart anlage but present in neural crest cells, indicating potential roles in directed cell migration during organogenesis .

How has CXCR4 evolved in Xenopus compared to other chemokine receptors?

Genomic analysis of chemokine receptors in Xenopus laevis reveals intriguing evolutionary patterns. The retention rate of CXC-type chemokine receptors (including CXCR4) is remarkably high at 86% (6/7) compared to only 29% (2/7) for CC-type and 33% (1/3) for XC-type receptors . This differential retention suggests selective pressure for dosage compensation or subfunctionalization specifically in CXC-type receptors. dN/dS analysis shows that both cxcr4.L and cxcr4.S have unusually low ratios (<0.1), indicating strong purifying selection . This stands in contrast to other chemokine genes that show evidence of relaxed selection or positive selection. The evolutionary conservation of CXCR4 compared to other chemokine receptors highlights its fundamental importance in vertebrate development and physiology.

What insights do homeologous CXCR4 genes in Xenopus laevis provide about genome evolution?

Xenopus laevis, being allotetraploid, possesses two homeologous CXCR4 genes (cxcr4.L and cxcr4.S) derived from its two subgenomes. Both genes are retained, unlike many homeologous pairs that underwent "genome fractionation" following whole-genome duplication . The retention of both genes suggests they may have undergone subfunctionalization in their expression domains or target specificities. Comparative analysis reveals that while only 0.3% of all homeologous genes have dN/dS ratios greater than 1, and 32% have ratios less than 0.1, both cxcr4.L and cxcr4.S fall into the latter category . This indicates unusually strong purifying selection acting on these genes, preserving their function despite genome duplication events. The retention and conservation of both CXCR4 homeologs provide a valuable system for studying the fate of duplicated genes in vertebrate evolution.

What are the recommended protocols for functional reconstitution of recombinant Xenopus CXCR4?

Successful functional reconstitution of xCXCR4 has been achieved using baculovirus-infected insect cells with recombinant Gi2 . This system provides a robust platform for studying receptor-ligand interactions and signaling mechanisms. The protocol involves:

  • Cloning the full-length xCXCR4 cDNA into a baculovirus expression vector

  • Co-expression with recombinant Gi2 in insect cells

  • Membrane preparation for functional assays

  • Validation using established ligands (SDF-1α or SDF-1β)

This system enables quantitative analysis of receptor activation and can be adapted for high-throughput screening of potential agonists or antagonists . When establishing this system, researchers should consider the importance of lipid composition in the reconstitution environment, as this can significantly impact receptor function and stability. Optimization of expression conditions, including viral titer and harvest time, is critical for obtaining sufficient quantities of functional receptor.

How can researchers effectively study CXCR4-SDF1 interaction in Xenopus developmental contexts?

To study CXCR4-SDF1 interactions in developmental contexts, researchers can employ several complementary approaches:

  • Temporal Expression Analysis: RT-PCR or RNA-Seq to track expression levels of both CXCR4 and SDF-1 throughout developmental stages, revealing coordinated regulation .

  • Spatial Expression Mapping: Whole mount in situ hybridization to localize expression patterns, particularly useful for identifying tissues where CXCR4 and SDF-1 might interact during development .

  • Functional Perturbation Studies:

    • Morpholino knockdown to reduce receptor or ligand expression

    • CRISPR/Cas9 gene editing for targeted mutations

    • Recombinant protein application for gain-of-function studies

  • Migration Assays: Ex vivo tissue explants to study directed cell migration in response to SDF-1 gradients, particularly useful for neural crest cell studies .

When designing these experiments, researchers should consider the potential redundancy between homeologous genes (cxcr4.L and cxcr4.S) and adjust their experimental approaches accordingly to account for potential compensatory mechanisms.

What analytical techniques can distinguish between CXCR4.L and CXCR4.S homeologs in experimental settings?

Distinguishing between CXCR4.L and CXCR4.S homeologs requires specialized techniques due to their sequence similarity:

  • Subgenome-Specific PCR: Design primers targeting divergent regions between the two homeologs for selective amplification. The 3' UTR regions often show higher divergence and are suitable targets for homeolog-specific primers .

  • RNA-Seq Analysis: Modern RNA-Seq techniques with appropriate bioinformatic pipelines can quantify expression of each homeolog separately by mapping reads to unique regions .

  • Homeolog-Specific CRISPR Targeting: Guide RNAs can be designed to target unique sequences in each homeolog for selective knockout studies.

  • Antibody-Based Differentiation: If sufficient protein sequence differences exist, antibodies can be raised against unique epitopes to distinguish the proteins in Western blot, immunohistochemistry, or flow cytometry.

TechniqueAdvantagesLimitations
Subgenome-Specific PCRHigh specificity, relatively simpleRequires careful primer design, limited to mRNA analysis
RNA-SeqGenome-wide analysis, quantitativeComputationally intensive, requires high-quality sequencing
CRISPR TargetingFunctional studies possiblePotential off-target effects, requires validation
Antibody-BasedProtein-level analysisChallenging to develop specific antibodies, costly

How does the signaling cascade of Xenopus CXCR4 compare to mammalian CXCR4 pathways?

Xenopus CXCR4 signaling maintains the core features of mammalian CXCR4 signaling despite sequence divergence. Like its mammalian counterpart, xCXCR4 primarily couples to Gi proteins, as demonstrated by successful functional reconstitution with recombinant Gi2 . This coupling leads to inhibition of adenylyl cyclase and activation of downstream pathways including calcium mobilization and chemotaxis .

The downstream effects include:

  • Calcium flux: Both xSDF-1 and hSDF-1α induce calcium release in cells expressing xCXCR4, indicating conservation of this signaling pathway .

  • Chemotactic response: Functional chemotaxis assays show that xCXCR4 mediates directional cell migration in response to SDF-1 gradients, a critical function for its developmental roles .

  • G-protein coupling: The interaction with heterotrimeric G-proteins appears to be conserved between species, suggesting fundamental constraints on this signaling interface .

What role does CXCR4 play in hematopoietic development in Xenopus compared to mammals?

CXCR4 appears to play conserved roles in hematopoiesis across vertebrates, with important implications for understanding the evolution of the hematopoietic system:

  • Expression in hematopoietic tissues: In Xenopus, CXCR4 mRNA is detected in the dorsal lateral plate, which represents the first site of definitive hematopoiesis in amphibian embryos . This corresponds functionally to the aorta-gonad-mesonephros (AGM) or para-aortic splanchnopleura in mammals.

  • Migratory behavior regulation: The expression pattern suggests that SDF-1/CXCR4 signaling regulates the migratory behavior of hematopoietic stem cells (HSCs) as they colonize the larval or fetal liver, similar to processes observed in mammals .

  • Evolutionary conservation: Hematopoietic defects observed in CXCR4-deficient mice may be explained by disturbances in HSC migration, a process that appears to be evolutionarily conserved in Xenopus .

This functional conservation despite the evolutionary distance between amphibians and mammals highlights the fundamental importance of CXCR4 in vertebrate hematopoiesis and provides an excellent model for studying the core mechanisms of HSC development and migration that have been maintained throughout vertebrate evolution.

How can recombinant Xenopus CXCR4 be utilized in drug discovery targeting human CXCR4-related diseases?

The functional conservation between Xenopus and human CXCR4 despite significant sequence divergence makes recombinant xCXCR4 a valuable tool for drug discovery:

  • Comparative pharmacology: Testing compounds against both xCXCR4 and hCXCR4 can identify molecules that interact with conserved functional domains, potentially leading to more robust therapeutics .

  • Binding pocket analysis: Recent high-resolution structures of CXCR4 complexed with small-molecule antagonists have revealed that both major and minor subpockets are critical for binding . Comparing these interactions across species can identify evolutionarily conserved binding sites that may be less prone to mutation-based resistance.

  • Developmental toxicity screening: Given the critical role of CXCR4 in development, Xenopus embryos expressing recombinant CXCR4 variants can serve as a model system for evaluating potential developmental toxicity of CXCR4-targeting drugs .

This approach is particularly relevant for developing therapeutics targeting CXCR4 in contexts such as HIV infection (where CXCR4 serves as a coreceptor) and cancer (where CXCR4 overexpression is associated with metastasis) . The cross-species conservation provides confidence that findings may translate to human applications while offering insights into fundamental mechanisms of receptor function.

What insights can the study of CXCR4 in cardiac neural crest migration provide for understanding congenital heart defects?

Research in Xenopus reveals a potentially critical role for CXCR4 in cardiac development through regulation of neural crest cell migration:

  • Complementary expression patterns: In Xenopus embryos, SDF-1 mRNA is detected in the embryonic heart, while CXCR4 mRNA appears to be absent from the heart anlage but present in neural crest cells . This complementary expression suggests a chemotactic mechanism.

  • Directed migration hypothesis: These findings suggest that SDF-1 expressed in the heart anlage may attract cardiac neural crest cells expressing CXCR4 to migrate to the primordial heart . This migration is essential for:

    • Septation of the cardiac outflow tract

    • Differentiation of the myocardium during early heart development

  • Evolutionary conservation: Similar mechanisms have been observed in mouse models, where disruption of CXCR4/SDF-1 signaling leads to septation defects resembling common congenital heart defects in humans .

This system provides a tractable model for studying the cellular and molecular mechanisms underlying cardiac neural crest migration and its contribution to heart development. Experimental manipulation of CXCR4 function specifically in neural crest cells could provide insights into the etiology of congenital heart defects and potentially inform regenerative medicine approaches for cardiac repair.

How can genome editing techniques be optimized for studying CXCR4 function in Xenopus?

Genome editing in Xenopus presents unique challenges and opportunities for studying CXCR4 function:

  • Homeolog-specific targeting: Given the presence of two CXCR4 homeologs in Xenopus laevis, genome editing strategies must be carefully designed to target either specific homeologs or both simultaneously :

    • Single homeolog targeting can reveal subfunctionalization

    • Dual targeting may be necessary to overcome functional redundancy

  • CRISPR/Cas9 optimization for Xenopus:

    • Guide RNA design should account for the high GC content often found in coding regions

    • Injection timing is critical: delivery at the 1-cell stage for global knockout or later stages for tissue-specific effects

    • Temperature optimization for Cas9 activity balancing efficiency with normal Xenopus development

  • Knock-in strategies:

    • Homology-directed repair can be used to introduce reporter genes or point mutations

    • Larger insertions may require optimization of donor template design and delivery methods

  • Validation approaches:

    • T7 endonuclease assays or high-resolution melt analysis for initial screening

    • Sequencing to confirm specific modifications

    • Functional assays (calcium flux, chemotaxis) to verify phenotypic effects

These approaches can be particularly valuable for dissecting the developmental roles of CXCR4, especially when combined with tissue-specific or inducible promoters to control the timing and location of genetic modifications.

What are common challenges in expressing functional recombinant Xenopus CXCR4 and how can they be addressed?

Researchers working with recombinant xCXCR4 may encounter several challenges:

  • Protein misfolding: As a seven-transmembrane receptor, CXCR4 can be prone to misfolding when overexpressed:

    • Solution: Optimize expression temperature (typically lower temperatures reduce misfolding)

    • Consider fusion tags that enhance folding (e.g., thioredoxin)

    • Use specialized host cells with enhanced chaperone expression

  • Post-translational modifications: Differences in glycosylation between expression systems can affect function:

    • Insect cells provide more "vertebrate-like" glycosylation than bacterial systems

    • Consider mammalian expression systems for studies requiring native-like glycosylation

    • Site-directed mutagenesis can be used to remove non-essential glycosylation sites

  • Functional verification: Confirming that recombinant xCXCR4 is properly folded and functional:

    • Calcium mobilization assays using fluorescent indicators

    • GTPγS binding assays to verify G-protein coupling

    • Surface expression confirmation via immunofluorescence or flow cytometry

  • Stability during purification: Membrane proteins often destabilize during extraction:

    • Use mild detergents (DDM, LMNG) for initial extraction

    • Consider nanodiscs or amphipols for long-term stability

    • Maintain glycerol (10-15%) in buffers to enhance stability

Addressing these challenges requires careful optimization of expression conditions and verification of functional activity using established assays before proceeding to experimental applications.

How can researchers effectively differentiate between general and CXCR4-specific effects in developmental studies?

Distinguishing CXCR4-specific effects from general developmental perturbations requires careful experimental design:

  • Multiple control approaches:

    • Use of structurally similar but functionally distinct chemokine receptors as controls

    • Rescue experiments with wild-type CXCR4 following knockdown or knockout

    • Dose-response studies to identify specific versus non-specific effects

  • Pathway-specific readouts:

    • Measure direct downstream effectors of CXCR4 (e.g., calcium flux, ERK phosphorylation)

    • Compare with markers of general developmental processes or stress responses

    • Use transcriptomic approaches to identify CXCR4-specific gene expression signatures

  • Temporal and spatial specificity:

    • Inducible or tissue-specific manipulation of CXCR4 function

    • Careful staging of embryos and precise documentation of developmental timing

    • Detailed phenotypic analysis focusing on tissues known to express CXCR4

  • Ligand competition studies:

    • Use of SDF-1 variants that selectively activate or inhibit CXCR4

    • Application of selective CXCR4 antagonists (e.g., AMD3100 analogs)

    • Comparison with effects of CXCR7/ACKR3 modulation, which also binds SDF-1

These approaches, especially when used in combination, can provide strong evidence for CXCR4-specific effects versus general developmental perturbations or off-target effects of experimental manipulations.

What considerations are important when comparing CXCR4 function across different model systems?

When comparing CXCR4 function between Xenopus and other model systems, researchers should consider:

  • Evolutionary context and sequence divergence:

    • Despite only 42% identity in extracellular domains between Xenopus and mammalian CXCR4, function is highly conserved

    • Focus on the 19 specifically conserved extracellular residues that may be critical for function

    • Consider both sequence and structural homology in comparative analyses

  • Developmental timing differences:

    • Account for differences in developmental rate and stage equivalence between species

    • Normalize developmental events to comparable landmarks rather than absolute time

    • Consider heterochrony (shifted timing of developmental events) in interpretation

  • Experimental system compatibility:

    • Different experimental approaches may have variable effectiveness across species

    • Standardize assay conditions when possible (temperature, pH, ionic strength)

    • Consider species-specific optimizations for techniques like gene editing or protein expression

  • Paralog and homeolog considerations:

    • Account for the presence of two CXCR4 homeologs in Xenopus laevis versus single copy in some other models

    • Compare with other tetraploid models when possible for more direct homeolog function comparison

    • Consider the possibility of subfunctionalization between paralogs/homeologs when interpreting results

This comparative approach can leverage the unique advantages of each model system while providing insights into conserved and divergent aspects of CXCR4 biology across vertebrate evolution.

What emerging technologies could advance our understanding of CXCR4 function in Xenopus development?

Several cutting-edge technologies hold promise for deepening our understanding of CXCR4 in Xenopus:

  • Single-cell transcriptomics: Applying scRNA-seq to developing Xenopus embryos could reveal cell-type-specific expression patterns of CXCR4 and its ligands, providing unprecedented resolution of signaling networks during development .

  • Live imaging of receptor dynamics:

    • CRISPR knock-in of fluorescent tags to endogenous CXCR4

    • Light-sheet microscopy for long-term, low-phototoxicity imaging

    • FRET-based sensors for real-time visualization of CXCR4 activation in vivo

  • Optogenetic and chemogenetic tools:

    • Development of light-activated or small-molecule-regulated CXCR4 variants

    • Spatiotemporal control of CXCR4 signaling during specific developmental events

    • Ability to dissect signaling dynamics with unprecedented precision

  • Cryo-EM structural analysis: Determining high-resolution structures of Xenopus CXCR4 in various activation states could reveal species-specific structural features and conservation of activation mechanisms .

  • Interactome mapping: Comprehensive identification of CXCR4 interacting partners in Xenopus could reveal novel components of signaling networks and species-specific adaptations.

These emerging approaches, especially when used in combination, promise to reveal new insights into the molecular mechanisms and developmental functions of CXCR4 in Xenopus and other vertebrates.

How might comparative studies of CXCR4 across amphibian species inform our understanding of evolutionary developmental biology?

Comparative studies of CXCR4 across amphibian species offer unique opportunities for evolutionary developmental biology:

  • Adaptation to different reproductive strategies:

    • Compare CXCR4 function between direct-developing and metamorphosing amphibians

    • Investigate potential differences in neural crest and hematopoietic cell migration patterns

    • Examine how CXCR4 signaling may be modified in species with different embryonic environments

  • Genome duplication effects:

    • Compare CXCR4 function between diploid (X. tropicalis) and allotetraploid (X. laevis) Xenopus species

    • Investigate potential subfunctionalization or neofunctionalization of CXCR4 homeologs

    • Determine how gene dosage affects developmental processes regulated by CXCR4

  • Climate adaptation:

    • Examine CXCR4 structure and function in amphibians adapted to different temperature regimes

    • Investigate potential temperature-sensitivity differences in signaling mechanisms

    • Identify adaptations that maintain critical CXCR4 functions across environmental conditions

  • Conservation hotspots:

    • Identify amino acid residues conserved across all amphibian CXCR4 orthologs

    • Compare with conservation patterns in other vertebrate lineages

    • Use this information to predict functionally critical domains and potential targets for experimental manipulation

Such comparative approaches can reveal how a critical signaling system has been conserved or modified through evolution while maintaining essential developmental functions.

How can multi-omics approaches enhance our understanding of CXCR4 regulation in Xenopus?

Integrating multiple omics technologies provides comprehensive insights into CXCR4 regulation:

  • Genomics-transcriptomics integration:

    • Identify cis-regulatory elements controlling CXCR4 expression through genomic analysis

    • Correlate with transcriptomic data to validate regulatory relationships

    • Examine homeolog-specific regulation patterns in X. laevis

  • Proteomics-interactomics analysis:

    • Identify post-translational modifications of CXCR4 in different developmental contexts

    • Map protein-protein interactions specific to Xenopus CXCR4

    • Compare with mammalian interaction networks to identify conserved and divergent signaling nodes

  • Metabolomics correlation:

    • Investigate metabolic changes associated with CXCR4 activation

    • Identify potential metabolic requirements for CXCR4-dependent migration

    • Connect CXCR4 signaling to broader metabolic networks during development

  • Integrated pathway analysis:

    • Construct comprehensive signaling networks incorporating all omics data

    • Identify feedback loops and regulatory circuits

    • Model temporal dynamics of CXCR4 signaling during key developmental transitions

This multi-omics approach can reveal regulatory mechanisms that may not be apparent from any single type of analysis, providing a systems-level understanding of how CXCR4 functions within the broader developmental program.

What insights can mathematical modeling provide about CXCR4-mediated cell migration in developing Xenopus embryos?

Mathematical modeling offers powerful tools for understanding complex CXCR4-mediated processes:

  • Chemotactic gradient modeling:

    • Simulate SDF-1 diffusion dynamics in three-dimensional embryonic environments

    • Model how physical barriers and tissue architecture affect gradient formation

    • Predict optimal receptor expression levels for effective directed migration

  • Cell-based modeling approaches:

    • Agent-based models of neural crest migration incorporating CXCR4-mediated responses

    • Cellular Potts models to simulate cell shape changes during migration

    • Vertex models for tissue-level effects of coordinated cell movements

  • Receptor dynamics modeling:

    • Ordinary differential equation models of CXCR4 activation, internalization, and recycling

    • Stochastic models of receptor-ligand interactions at low molecule numbers

    • Spatial reaction-diffusion models of receptor clustering and signaling microdomains

  • Multi-scale integration:

    • Link molecular-level receptor dynamics to cellular movement patterns

    • Connect individual cell behaviors to tissue-level morphogenetic outcomes

    • Predict developmental consequences of specific CXCR4 mutations or perturbations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.