Recombinant Xenopus laevis C-X-C chemokine receptor type 4-B (cxcr4-b)

Shipped with Ice Packs

In Stock

Cat. No.

BT2141303

Source

in vitro E.coli expression system

Synonyms

cxcr4-b; cxcr4; C-X-C chemokine receptor type 4-B; CXC-R4-B; CXCR-4-B; Stromal cell-derived factor 1 receptor B; SDF-1 receptor B

Quick Inquiry

Description

Expression and Functional Roles

CXCR4-B is part of the CXCR4 family, which includes CXCR4-A and CXCR4-B in X. laevis. These receptors are critical for SDF-1/CXCL12 signaling, regulating processes such as:

Neural crest cell migration
Hematopoietic stem cell homing
Cardiac development

While CXCR4-A has been extensively studied in Xenopus embryogenesis (e.g., heart development and hematopoiesis) , CXCR4-B’s specific roles remain unclear. Syntenic analysis in X. tropicalis and X. laevis suggests subfunctionalization between CXCR4-A and CXCR4-B, with potential differences in tissue-specific expression .

Functional Studies and Research Gaps

Ligand Binding: CXCR4-A binds SDF-1/CXCL12 with high affinity, activating Gαi proteins and triggering calcium signaling . CXCR4-B may share this mechanism.
Developmental Signaling: CXCR4-A regulates neural crest cell migration to the heart . CXCR4-B could participate in analogous pathways, though experimental validation is lacking.

Table 1: Comparison of CXCR4-A and CXCR4-B in Xenopus laevis

Feature	CXCR4-A	CXCR4-B
Expression	Nervous system, neural crest, spleen	Limited data; inferred from homology
Function	SDF-1 signaling, hematopoiesis, cardiac development	Hypothetical (based on CXCR4-A)
Research	Extensively characterized	No direct studies reported

Applications in Research

CXCR4-B recombinant proteins are used in:

Structural Biology: Study of GPCR-ligand interactions (e.g., SDF-1/CXCL12) .
Signaling Pathway Analysis: Investigation of G-protein coupling and downstream effects (e.g., ERK or NF-κB activation) .
Drug Development: Screening for CXCR4-specific inhibitors or agonists .

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will then prepare the product according to your request.

Lead Time

Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.

Shelf Life

The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type will be determined during the manufacturing process.

The tag type is decided during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.

Synonyms

cxcr4-b; cxcr4; C-X-C chemokine receptor type 4-B; CXC-R4-B; CXCR-4-B; Stromal cell-derived factor 1 receptor B; SDF-1 receptor B

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-358

Protein Length

full length protein

Species

Xenopus laevis (African clawed frog)

Target Names

cxcr4-b

Target Protein Sequence

MDGFSGGIDINIFDGNSTENGSGDFEDFIEPCFMQENSDFNRIFLPTIYSFIFLLGIIGN GLVVVVMGYQKKSRTMTDKYRLHLSVADLLFVFTLPFWSVDAAIGWYFKEFLCKAVHVIY TVNLYSSVLILAFISLDRYLAIVHATNSQGSRKMLADKVVYAGVWLPALLLTVPDLVFAS VSNENGQFVCDRIYPIDNRETWTVGFRFLHITVGLILPGLIILVCYCVIISKLSHSKGHQ KRKALKTTVILILAFFACWLPYYVCLTTDTFMMLGLVKADCIWENTLHKAISITEALAFF HCCLNPILYAFLGAKFKKSAQNAFTSVSRGSSLKILSKKRAGLSSVSTESESSSFHSS

Uniprot No.

Q7ZXJ7

Target Background

Function

This protein serves as a receptor for the C-X-C chemokine CXCL12/SDF-1. It transduces a signal by increasing the intracellular calcium ion levels. Signaling with CXCL12/SDF-1 facilitates the directional movement of mesodermal cells during gastrulation. It might play a role in the migration of embryonic presumptive primordial germ cells (pPGCs). Additionally, it may be involved in regulating the migration of hematopoietic stem cells into the larval liver.

Gene References Into Functions

Essential for the migration of a significant number of cells during gastrulation. PMID: 17239342

Database Links

KEGG: xla:380373

UniGene: Xl.11336

Protein Families

G-protein coupled receptor 1 family

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cytoplasm. Nucleus. Early endosome. Late endosome. Lysosome.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Xenopus laevis C-X-C chemokine receptor type 4-B (cxcr4-b)

Description

Expression and Functional Roles

Functional Studies and Research Gaps

Table 1: Comparison of CXCR4-A and CXCR4-B in Xenopus laevis

Applications in Research

Product Specs

Target Background

Quick Inquiry

Category

Service