Recombinant Xenopus laevis Calcitonin gene-related peptide type 1 receptor (calcrl)

Shipped with Ice Packs
In Stock

Description

Functional Characterization

Calcrl functions as a G-protein-coupled receptor (GPCR) that requires interaction with Receptor Activity-Modifying Proteins (RAMPs) for ligand specificity :

  • With RAMP1: Forms a high-affinity CGRP receptor, enabling cAMP signaling .

  • With RAMP2/3: Converts to an adrenomedullin (ADM) receptor, linked to lymphatic and cardiovascular regulation .

Key Findings:

  • RAMPs regulate Calcrl’s glycosylation state (core vs. mature glycosylation), which dictates cell-surface localization and ligand selectivity .

  • In Xenopus lateral line organs, Calcrl mediates CGRP-induced afferent nerve activation post-metamorphosis, highlighting developmental regulation .

3.1. Mechanistic Studies

  • Lymphatic Dysfunction: Global Calcrl knockout in mice causes multi-organ lymphangiectasia, impaired chyle transport, and chronic edema .

  • Astrocyte Signaling: CGRP binding to Calcrl triggers Ca²⁺ responses in astrocytes, implicating it in neuron-glia communication .

3.2. Pharmacological Profiling

  • Antagonist Sensitivity: CGRP fragment 8–37 competitively inhibits Calcrl-RAMP1 complexes (IC₅₀: ~1 μM) .

  • Species Specificity: Xenopus Calcrl shares 33% identity with human CALCRL but diverges in ligand-binding regions .

Comparative Analysis with Orthologs

ParameterXenopus laevis CalcrlHuman CALCRL
Protein Length443 aa (34–476)461 aa
Expression SystemE. coliMammalian cells
Key LigandsCGRP, ADMCGRP, ADM, amylin
Disease LinksDevelopmental defectsLymphatic malformations

Technical Considerations

  • Purity: Validated by SDS-PAGE and Western blot .

  • Functional Assays: cAMP accumulation and radioligand binding (e.g., ¹²⁵I-CGRP) confirm receptor activity .

  • Storage: Lyophilized form avoids repeated freeze-thaw cycles, which degrade activity .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve Calcrl-RAMP complexes.

  • Therapeutic Targeting: Screening for antagonists to treat migraine (CGRP-dependent pathways) or lymphatic disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your reconstitution process.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a preference for a particular tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
calcrl; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-476
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
SQEQEAKTSVPEERQVGVTQNKIMTAQYECYQKIMQEPAHGKEGQFCNRTWDGWLCWGDV AAGIISEQRCPDYFQDFDPSEKVTKECGKNGHWFRHPDSNRTWTNYTRCNTFTHEKVKTA LNLYYLTIIGHGLSIASLLISLGIFFYFKNLSCQRITLHKNLFFSFVCNSIITIISLSAV ANNQALVATNPVICKISQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYLL GWGFPLIPACIHAVARSLYYNDNCWISSETHLLYIIHGPICAALLVNLFFLLNIVRVLIT KLKVTHQAESNLYMKAVRATLILVPLLGIEFVLFPWKPEGRIAEEIYDYVMHILMHYQGL LVATIFCFFNGEVQAVLKRHWNQYRIQFGSFAHSEGLRSASYTVSSISEIQGTTYTHDYS EHSNGKNCHDMENVFFKTEKQYM
Uniprot No.

Target Background

Function
This receptor, a member of the G protein-coupled receptor family, is responsible for recognizing calcitonin-gene-related peptide (CGRP). The receptor's specificity can be modulated by accessory proteins. The activation of this receptor is mediated by G proteins, which subsequently stimulate adenylyl cyclase.
Database Links

KEGG: xla:379898

UniGene: Xl.9320

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Calcitonin Gene-Related Peptide Type 1 Receptor in Xenopus laevis?

The Calcitonin Gene-Related Peptide Type 1 Receptor (CALCRL, also known as CRLR) in Xenopus laevis functions as a G protein-coupled receptor (GPCR) that requires a Receptor Activity Modifying Protein (RAMP) for proper functioning. Specifically, CALCRL requires RAMP1 for functional expression as a CGRP receptor. Without RAMP1, CALCRL alone cannot induce significant CGRP binding or responses. The reconstituted CGRP receptor formed by CALCRL and RAMP1 displays virtually identical pharmacology to CGRP receptors found in other cell types. This receptor system responds to CGRP by increasing intracellular cyclic AMP levels and binding specifically to 125I-labeled CGRP1 .

How does CALCRL expression differ during Xenopus development?

CALCRL expression patterns vary throughout Xenopus laevis development, with expression changes correlating with specific developmental landmarks. While complete expression mapping throughout all Nieuwkoop and Faber (NF) developmental stages has not been fully characterized in the provided materials, researchers can reference the comprehensive developmental stage tables to design experiments targeting specific developmental windows. These stages range from fertilization (NF stage 1) through cleavage stages and organogenesis to metamorphosis (NF stage 66) .

What expression systems are available for recombinant Xenopus laevis CALCRL production?

Multiple expression systems have been developed for recombinant Xenopus laevis CALCRL production, each with distinct advantages:

Expression SystemProduct ID ExampleSpecial Features
E. coliCSB-EP767255XBE1Cost-effective, high yield
E. coli with biotinylationCSB-EP767255XBE1-BAvi-tag Biotinylated via BirA technology
YeastCSB-YP767255XBE1Enhanced post-translational processing
BaculovirusCSB-BP767255XBE1Improved folding and activity
Mammalian cellCSB-MP767255XBE1Most native-like modifications

The selection of an appropriate expression system depends on experimental requirements for protein folding, post-translational modifications, and downstream applications .

How can the Xenopus oocyte system be utilized to study CALCRL functionality?

Xenopus oocytes provide an excellent heterologous expression system for studying CALCRL functionality. Methods include:

  • Co-expressing CALCRL with RAMP1 by microinjecting their respective cRNAs into Xenopus oocytes

  • Using cystic fibrosis transmembrane regulator (CFTR) as a sensitive readout for receptors that couple positively to adenylyl cyclase

  • Measuring electrophysiological responses to CGRP application using two-electrode voltage clamp recordings

  • Quantifying dose-response relationships by normalizing peak inward current responses

Experimental data shows that co-expression of CALCRL with RAMP1 produces robust responses to CGRP, whereas CALCRL alone does not alter the endogenous response. When co-expressed, the EC50 for CGRP is approximately 9±1 nM under control conditions, shifting to 1,400±400 nM in the presence of the antagonist CGRP8-37 .

What ligands can be used to characterize the CALCRL receptor in Xenopus laevis?

Several peptide ligands have been characterized for their effects on the Xenopus laevis CALCRL receptor, particularly in the lateral line organ:

  • Rat α-CGRP and β-CGRP produce dose-dependent increases in afferent nerve fiber discharge rate with EC50 values of approximately 1 μM, resulting in rate increases of 31.2% and 18.9%, respectively

  • Human analog of α-CGRP (h[Tyro]α-CGRP) produces a 10.3% increase in discharge rate with similar EC50

  • The peptide fragment rCGRP8-37, a selective CGRP1 receptor antagonist, competitively inhibits responses to α-CGRP

  • Diacetoamidomethyl cysteine CGRP (r[Cys(ACM)2,7]α-CGRP), a CGRP2 agonist, does not significantly alter discharge rate

  • Rat amylin produces minimal effects (<7% increase) even at high concentrations

These pharmacological profiles help distinguish CGRP receptor subtypes and characterize their functional properties in native tissue.

How do RAMP proteins alter CALCRL ligand specificity in Xenopus?

RAMP proteins fundamentally determine the ligand specificity of CALCRL in Xenopus. The interaction between CALCRL and different RAMPs creates receptors with distinct pharmacological profiles:

  • CALCRL + RAMP1: Forms a CGRP receptor that responds selectively to CGRP with high affinity

  • CALCRL without RAMP1: Shows negligible responses to CGRP, adrenomedullin, calcitonin, or amylin

In functional studies using Xenopus oocytes expressing RAMP1, there is a marked specificity for CGRP over related peptides including adrenomedullin (ADM), calcitonin, and amylin. This ligand selectivity profile demonstrates that RAMP1 specifically enables CGRP-mediated responses rather than generally enhancing all peptide-mediated signaling .

What are the optimal conditions for reconstituting lyophilized recombinant Xenopus CALCRL protein?

For optimal reconstitution of lyophilized recombinant Xenopus CALCRL:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Choose a buffer appropriate for downstream applications:

    • PBS (pH 7.4) for general applications

    • Specific binding buffers for receptor-ligand interaction studies

    • Avoid buffers containing reducing agents when working with proteins containing disulfide bonds

  • Add buffer slowly to the lyophilized powder while gently rotating the vial

  • Allow the protein to rehydrate completely at 4°C for at least 20 minutes before aliquoting

  • Minimize freeze-thaw cycles by preparing appropriate single-use aliquots

  • Verify protein integrity via SDS-PAGE before experimental use (expected purity >85%)

How can researchers distinguish between endogenous and recombinant CALCRL in experimental systems?

To distinguish between endogenous and recombinant CALCRL in experimental systems:

  • Utilize epitope tags incorporated into recombinant proteins:

    • Common tags include Myc, FLAG, or His tags that can be detected via specific antibodies

    • Fluorescent protein fusions enable direct visualization

    • Biotinylated tags (e.g., AviTag) allow for streptavidin-based detection and purification

  • Employ comparative pharmacology:

    • Measure responses to specific agonists and antagonists

    • Native Xenopus CGRP receptors in oocytes show particular pharmacological properties (e.g., pA2 of 8.4 with CGRP8-37)

    • Altered pharmacological profiles may indicate successful expression of recombinant receptors

  • Use fluorescence-activated cell sorting (FACS) for cell surface expression analysis of tagged receptors, as demonstrated with Myc-tagged CRLR in HEK293T cells

How does Xenopus laevis CALCRL differ from mammalian CALCRL homologs?

While Xenopus laevis CALCRL shares fundamental properties with mammalian homologs, there are important distinctions:

  • Functional Conservation:

    • Both require RAMP1 for functioning as CGRP receptors

    • Both couple to adenylyl cyclase, increasing intracellular cAMP

  • Pharmacological Differences:

    • Xenopus CGRP receptors in the lateral line organ show EC50 values of approximately 1 μM for rat CGRP isoforms

    • Mammalian CGRP receptors typically show higher potency (lower EC50 values)

    • Differential responses to CGRP analogs and related peptides like adrenomedullin and amylin

  • Expression Patterns:

    • Xenopus expresses functional CGRP receptors in specialized sensory organs like the lateral line

    • These receptors likely play roles in sensory processing unique to aquatic vertebrates

What are the advantages of using Xenopus laevis for CALCRL research compared to mammalian models?

Xenopus laevis offers several unique advantages for CALCRL research:

  • Developmental Accessibility:

    • Well-characterized developmental stages allow precise timing of experiments

    • External development facilitates observation and manipulation

    • Transparent embryos enable real-time imaging of receptor expression and function

  • Oocyte Expression System:

    • Large Xenopus oocytes provide an established heterologous expression system

    • Endogenous CGRP receptors provide internal controls

    • Co-expression with CFTR enables sensitive functional readouts

  • Specialized Structures:

    • The lateral line organ presents a unique model for studying CGRP in mechanosensory systems

    • CGRP co-localization with acetylcholine in efferent fibers innervating hair cells offers insights into sensory modulation

  • Evolutionary Perspective:

    • Studying CALCRL in amphibians provides evolutionary context for receptor function

    • Helps distinguish conserved versus species-specific functional aspects

How do RAMPs regulate the cell surface trafficking of CALCRL in Xenopus systems?

The regulation of CALCRL trafficking by RAMPs in Xenopus involves complex cellular mechanisms:

  • RAMP1 appears to transport CRLR to the cell surface, as demonstrated in HEK293T cells where FACS analysis of Myc-epitope-tagged CRLR showed significant cell-surface expression only when co-expressed with RAMP1.

  • The putative structure of RAMP1 includes an amino-terminal signal sequence and a single transmembrane domain near the carboxy terminus, suggesting a membrane topology conducive to chaperoning CRLR.

  • RAMP1 likely performs dual functions:

    • Transport of CRLR to the plasma membrane

    • Modulation of CRLR conformation to enable CGRP binding

  • In Xenopus oocytes, which contain endogenous CGRP receptors, RAMP1 expression potentiates CGRP responses, suggesting it may enhance surface expression or coupling of endogenous receptors as well as recombinant ones .

What methodological approaches can resolve contradictory data regarding CALCRL signaling in different experimental systems?

To resolve contradictory data regarding CALCRL signaling across experimental systems:

  • Systematic Comparison of Expression Systems:

    • Compare CALCRL function in all available expression systems (E. coli, yeast, baculovirus, mammalian)

    • Evaluate factors like post-translational modifications, membrane composition, and G-protein coupling efficiency

  • Comprehensive Pharmacological Profiling:

    • Develop standardized protocols for dose-response relationships

    • Test multiple ligands (CGRP isoforms, adrenomedullin, amylin) across all systems

    • Employ multiple readouts (cAMP, Ca2+, ERK phosphorylation) to capture signaling diversity

  • Genetic Approaches:

    • Use CRISPR/Cas9 to generate CALCRL knockouts in Xenopus

    • Rescue with wild-type or mutant receptors to identify critical domains

    • Create chimeric receptors between Xenopus and mammalian CALCRL to map functional differences

  • Native Tissue Context:

    • Compare recombinant receptor properties with those in native Xenopus tissues

    • Assess the influence of tissue-specific factors like receptor reserve and signal transduction components

    • Consider developmental stage-specific effects using the Xenopus developmental staging system

How might CALCRL function in non-neural tissues during Xenopus development?

While current research has focused on CALCRL in neural contexts like the lateral line, its potential functions in non-neural tissues during Xenopus development warrant investigation:

  • Vascular Development:

    • CGRP receptors play crucial roles in mammalian vascular regulation

    • Expression mapping during key stages of Xenopus vasculogenesis (approximately NF stages 28-42) could reveal developmental roles

  • Metamorphosis:

    • The profound tissue remodeling during Xenopus metamorphosis (NF stages 59-66) likely involves complex signaling networks

    • CALCRL may participate in coordination of tissue-specific responses during this critical period

  • Craniofacial Development:

    • CGRP signaling influences mammalian craniofacial development

    • The accessible nature of Xenopus embryos makes them ideal for studying potential roles in neural crest-derived tissues

  • Regenerative Processes:

    • Xenopus tadpoles possess remarkable regenerative abilities

    • CALCRL signaling might contribute to injury responses and tissue regeneration

What technological advances would facilitate high-resolution structural studies of Xenopus CALCRL-RAMP complexes?

Advanced structural studies of Xenopus CALCRL-RAMP complexes would benefit from:

  • Optimized Expression Strategies:

    • Development of stabilized constructs with thermostabilizing mutations

    • Incorporation of fusion proteins that enhance expression and crystallization

    • Selection of optimal detergents or nanodiscs for membrane protein purification

  • Cutting-Edge Structural Biology Techniques:

    • Cryo-electron microscopy for high-resolution structure determination without crystallization

    • Hydrogen-deuterium exchange mass spectrometry to map protein-protein interaction interfaces

    • Single-particle analysis to capture conformational diversity

  • Functional Validation Approaches:

    • Site-directed fluorescence spectroscopy to correlate structural changes with function

    • Design of conformation-specific antibodies or nanobodies

    • Development of biosensors to monitor receptor activation in real-time

  • Computational Methods:

    • Molecular dynamics simulations of the CALCRL-RAMP1 complex in lipid bilayers

    • Machine learning approaches to predict functional consequences of mutations

    • Integration of structural data with evolutionary analysis across vertebrate species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.