Recombinant Xenopus laevis Calcium-binding mitochondrial carrier protein SCaMC-1-A (slc25a24-a)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Calcium Handling

SCaMC-1-A facilitates ATP-Mg transport across the mitochondrial inner membrane, exchanging it for phosphate . This activity is modulated by cytosolic calcium levels via its N-terminal EF-hand domains, enabling it to:

  • Buffer mitochondrial calcium influx during cellular stress .

  • Regulate mitochondrial permeability transition (mPT), a process linked to necrosis and apoptosis .

  • Protect against oxidative stress-induced cell death by stabilizing mitochondrial membrane potential .

Studies in human orthologs suggest SCaMC-1-A may act as a "calcium sensor," coupling cytosolic calcium signals to mitochondrial energy output .

3.1. Oxidative Stress and Cell Survival

Silencing SCaMC-1 in human cell lines increases susceptibility to H₂O₂-induced mPT and necrosis, while overexpression enhances resistance to calcium overload . These findings imply conserved roles in stress adaptation across species.

3.2. Calcium Signaling in Disease Models

In cancer cells, SCaMC-1 upregulation desensitizes mitochondria to calcium overload, promoting survival under metabolic stress . Similar mechanisms may exist in Xenopus models, though direct evidence is limited.

3.3. Comparative Analysis with Xenopus tropicalis Ortholog

FeatureXenopus laevis SCaMC-1-A (Q7ZY36)Xenopus tropicalis SCaMC-1 (Q5XHA0)
Sequence Identity~85%Reference
EF-Hand Motifs4 motifs (positions 50-150)4 motifs (positions 50-150)
Tissue ExpressionUbiquitous (predicted)Mitochondria-rich tissues (e.g., liver)

Technical Considerations for Experimental Use

  • Reconstitution: Optimize protein concentration (0.1–1.0 mg/mL) with glycerol for stability .

  • Activity Assays: Measure ATP-Mg/phosphate exchange using radiolabeled substrates or fluorescent dyes.

  • Limitations: Species-specific functional studies are sparse; inferences rely on human/mammalian data .

Future Directions

  • Elucidate SCaMC-1-A’s role in Xenopus development and stress responses.

  • Explore its interaction with mitochondrial calcium uniporter (MCU) complexes.

  • Develop inhibitors/activators for therapeutic targeting in calcium dysregulation disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
slc25a24-a; scamc1-a; Calcium-binding mitochondrial carrier protein SCaMC-1-A; Small calcium-binding mitochondrial carrier protein 1-A; Solute carrier family 25 member 24-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a24-a
Target Protein Sequence
MLEQVQKFLLSRAACEGSDSHTRYAELFHKLDVNKDGKVDILELQEGLKAMGMAVGKGAE EKIVEAGDTNKDGHLDFGEFMRYLEEHEKKMKIAFTSLDKNKDGKIESSEVMNSLKTLGI NISLDHAEKILKSMDSDGTLTVDWNEWRDHFLFNPADNIQQIIRFWKHSTVLDIGDSLTI PDEFTEEEKKTGQWWKHLLAGGMAGAVSRTGTAPLDRLKVMMQVHGTKGNSNIITGLKQM VKEGGVRSLWRGNGVNVIKIAPETAMKFWAYEQYKKLFTSESGKLGTAERFIAGSLAGAT AQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQKEGILAFYKGYIPNILGIIPYAGID LAIYETLKNYWLQNYAKDSANPGVLVLLGCGTVSSTCGQLASYPLALIRTRMQAQASIEG APQLNMGGLFRKIVAKEGFFGLYTGIAPNFLKVLPAVSISYVVYEKMKIQLGI
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Mediates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP against phosphate ions, facilitating the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive when cytosolic calcium levels are low and is activated by an increase in cytosolic calcium levels. May contribute to protecting cells against oxidative stress-induced cell death, possibly by promoting the formation of calcium-phosphate precipitates in the mitochondrial matrix, thereby buffering calcium levels within the mitochondrial matrix.
Database Links

KEGG: xla:398474

UniGene: Xl.61195

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SCaMC-1-A and what is its role in mitochondrial function?

SCaMC-1-A (slc25a24-a) belongs to the subfamily of short calcium-binding mitochondrial carriers (SCaMC). This protein mediates ATP-Mg(2-)/Pi(2-) and ADP/Pi transport across the mitochondrial membrane in a calcium-dependent manner. The protein contains a characteristic mitochondrial carrier domain at the C-terminus and an N-terminal extension with four EF-hand calcium-binding motifs similar to calmodulin .

The primary function of SCaMC-1-A is to facilitate adenine nucleotide transport into mitochondria following increases in cytosolic calcium concentration. These transported nucleotides enhance mitochondrial calcium buffering capacity by promoting calcium-phosphate precipitation in the matrix . This buffering activity plays a crucial role in protecting cells against mitochondrial permeability transition (mPT), a process linked to cell death under various stress conditions .

How does SCaMC-1-A differ structurally from other mitochondrial carrier proteins?

Unlike conventional mitochondrial carriers that typically consist of only a carrier domain (~300 amino acids), SCaMC-1-A is larger (~500 amino acids) due to its additional N-terminal calcium-sensing domain . This structural arrangement allows SCaMC-1-A to be regulated by cytosolic calcium without requiring calcium entry into the mitochondria.

The protein's structure can be divided into two major functional domains:

  • N-terminal domain: Contains four EF-hand calcium-binding motifs that face the cytosolic side

  • C-terminal domain: Contains the characteristic mitochondrial carrier domain responsible for metabolite transport

Importantly, experiments have shown that the N-terminal extensions are dispensable for correct mitochondrial targeting of the polypeptides, suggesting their primary role is regulatory rather than localization .

What are the optimal storage and handling conditions for recombinant SCaMC-1-A?

For optimal preservation of SCaMC-1-A activity, researchers should follow these guidelines :

Storage conditions:

  • Primary storage: -20°C for regular use, -80°C for extended preservation

  • Buffer composition: Tris-based buffer with 50% glycerol (optimized for protein stability)

  • Aliquoting: Create working aliquots to avoid repeated freeze-thaw cycles

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week

Handling precautions:

  • Avoid repeated freezing and thawing as this can compromise protein integrity

  • When designing experiments, consider the high glycerol content of the storage buffer

  • For functional assays, buffer exchange may be necessary to remove glycerol

How can researchers effectively measure SCaMC-1-A transport activity?

Transport activity of SCaMC-1-A can be measured using several complementary approaches:

In permeabilized cells:

  • Selectively permeabilize the plasma membrane using digitonin while keeping mitochondria intact

  • Use CAT (carboxyatractyloside) to inhibit the adenine nucleotide translocase

  • Measure calcium-dependent ATP-Mg or ADP uptake using either:

    • Radiolabeled nucleotides with rapid filtration techniques

    • Luciferase-based ATP detection systems

Experimental evidence shows that SCaMC-1 mediates calcium-dependent transport with activation occurring at micromolar calcium concentrations (~3-4 µM) . The transport activity can be reversed by phosphate (Pi) addition, confirming it operates as an exchange mechanism rather than a uniporter .

What techniques are most effective for studying mitochondrial calcium handling in relation to SCaMC-1-A?

Several complementary techniques provide insights into SCaMC-1-A's role in mitochondrial calcium homeostasis:

Aequorin-based calcium measurements:

  • Transfect cells with mitochondrially-targeted aequorin (mtAEQwt for physiological ranges or mtAEQmut for higher calcium concentrations)

  • Reconstitute with coelenterazine and measure luminescence during calcium mobilization experiments

  • This approach directly quantifies free calcium concentrations in the mitochondrial matrix

Calcium uptake and efflux assays:

  • In isolated mitochondria, measure calcium uptake using fluorescent indicators like Calcium-Green in the extra-mitochondrial space

  • For efflux studies, load mitochondria with calcium, then block uptake with Ruthenium Red (RR) and monitor calcium release

Light scattering for calcium-phosphate precipitation:

  • Measure absorbance at 540 nm to detect apparent mitochondrial contraction

  • This indicates formation of calcium-phosphate precipitates, which is enhanced by adenine nucleotides transported by SCaMC-1-A

What evidence links SCaMC-1-A to cancer cell survival?

Comprehensive research demonstrates that SCaMC-1 plays a significant role in cancer cell survival through several mechanisms:

  • Expression pattern analysis: Gene expression studies reveal that SCaMC-1 overexpression is a general feature of transformed and cancer cell lines .

  • Functional impact: Knockdown of SCaMC-1 in cancer cells results in:

    • Reduced mitochondrial calcium buffering capacity

    • Increased sensitivity to oxidative stress-induced cell death

    • Enhanced vulnerability to mitochondrial permeability transition

  • Rescue experiments: Re-expression of SCaMC-1 in knockdown cells restores protection against oxidative stress and ceramide-induced cell death, confirming the protein's direct role in survival mechanisms .

The protective effect appears specific to oxidative stress-induced necrotic cell death, with no impact on apoptosis triggered by staurosporine . This suggests SCaMC-1-A selectively protects against mitochondrial permeability transition-dependent cell death pathways.

What mechanisms explain SCaMC-1-A's protective effect against cell death?

SCaMC-1-A protects cells against oxidative stress-induced death through a multi-step process involving calcium buffering:

The importance of this mechanism is confirmed by experiments showing that CsA and BKA (inhibitors of mPT) prevent mitochondrial depolarization in SCaMC-1-KD cells .

How might SCaMC-1-A serve as a potential target for cancer therapy?

Based on research findings, SCaMC-1-A presents several characteristics that make it a promising target for anticancer interventions:

  • Differential expression: SCaMC-1 is overexpressed in cancer cells compared to normal tissues, potentially offering a selective therapeutic window .

  • Mechanistic rationale: Inhibiting SCaMC-1-A would:

    • Reduce mitochondrial calcium buffering capacity

    • Sensitize cancer cells to oxidative stress

    • Lower the threshold for mitochondrial permeability transition

  • Potential combination approaches:

    • SCaMC-1-A inhibitors could synergize with:

      • Conventional chemotherapies that increase oxidative stress

      • Agents that disrupt calcium homeostasis

      • Radiotherapy, which generates reactive oxygen species

The research suggests that targeting SCaMC-1-A might be particularly effective against cancer types that rely heavily on mitochondrial calcium buffering for survival under the intrinsic oxidative stress conditions associated with malignancy .

How does cytosolic calcium regulate SCaMC-1-A transport function?

SCaMC-1-A activity is regulated by cytosolic calcium through direct binding to EF-hand motifs in its N-terminal domain:

  • Calcium binding mechanism:

    • The N-terminal domain contains four EF-hand calcium-binding motifs

    • When cytosolic calcium levels rise, calcium ions bind to these motifs

    • This binding induces conformational changes that activate the transport function

  • Calcium sensitivity:

    • Transport activity is calcium-dependent with activation occurring at micromolar concentrations

    • Half-maximal activation occurs at approximately 3-4 μM calcium

    • This sensitivity range allows the carrier to respond to physiological calcium signaling events

  • Transport specifics:

    • The activated carrier mediates exchange of ATP-Mg²⁺/Pi²⁻ and ADP/Pi²⁻

    • Transport activity can be reversed by phosphate addition

    • The process is distinct from the activity of the adenine nucleotide translocase (ANT), as evidenced by its resistance to carboxyatractyloside (CAT)

This calcium regulation mechanism allows mitochondria to respond to cytosolic calcium signals without requiring calcium entry into the organelle, providing an additional layer of regulation for mitochondrial metabolism .

What is the relationship between SCaMC-1-A activity and mitochondrial calcium dynamics?

SCaMC-1-A influences mitochondrial calcium handling through indirect mechanisms:

  • Effect on mitochondrial calcium buffering:

    • In cells with SCaMC-1 knockdown, mitochondrial calcium levels rise significantly higher during stimulation compared to control cells

    • This occurs despite identical cytosolic calcium transients, indicating the effect is specific to mitochondrial calcium handling

  • Mechanism based on experimental evidence:

    • SCaMC-1-KD cells show higher free calcium in the mitochondrial matrix when exposed to the same calcium load

    • This is not due to increased calcium uptake, as mitochondria from both control and SCaMC-1-KD cells take up calcium at the same rate

    • Rather, it reflects reduced calcium buffering capacity in the matrix

  • Calcium efflux observations:

    • After calcium loading, SCaMC-1-KD mitochondria show faster calcium efflux

    • This indicates higher free calcium levels in the matrix of these mitochondria

    • The finding supports the role of adenine nucleotides in enhancing calcium precipitation and reducing free calcium

This relationship explains how SCaMC-1-A modulates mitochondrial calcium dynamics without directly transporting calcium ions themselves.

How do different SCaMC isoforms compare structurally and functionally?

The SCaMC subfamily includes multiple isoforms with distinct characteristics:

Structural comparison:

  • Three SCaMC genes have been identified in the human genome

  • All encode proteins of approximately 500 amino acids with 70-80% sequence identity

  • All contain:

    • A characteristic mitochondrial carrier domain at the C-terminus

    • An N-terminal extension with EF-hand calcium-binding motifs

Functional diversity:

  • SCaMC-1 is the human orthologue of rabbit Efinal protein (originally reported in peroxisomes)

  • SCaMC-2 is the human orthologue of rat MCSC protein (up-regulated by dexamethasone in AR42J cells)

  • SCaMC-2 has four variants generated by alternative splicing:

    • All variants share a common C-terminus

    • They differ in their N-terminal domains

    • Some variants have lost one to three EF-hand motifs, likely affecting calcium sensitivity

This diversity suggests that different SCaMC isoforms and variants may respond to different calcium concentration thresholds, providing fine-tuned regulation of adenine nucleotide transport across tissues and conditions.

What distinguishes SCaMC proteins from other calcium-binding mitochondrial carriers?

SCaMC proteins represent one of two known subfamilies of calcium-binding mitochondrial carriers:

Comparison with aspartate/glutamate carriers (AGC):

FeatureSCaMC familyAGC family (Aralar1/Citrin)
Size~500 amino acids~600-700 amino acids
EF-hand motifs4 motifs8 motifs
SubstratesATP-Mg/Pi, ADP/PiAspartate/Glutamate
Metabolic roleAdenine nucleotide transportMalate-aspartate shuttle
Ca²⁺ sensitivityMicromolar rangeSubmicromolar range
Expression patternSCaMC-1 elevated in cancerTissue-specific distribution

Both families share the fundamental principle of calcium-regulated transport without requiring calcium entry into mitochondria, representing evolutionary adaptations that allow cytosolic calcium signals to influence mitochondrial metabolism through different pathways .

What research approaches are most valuable for investigating SCaMC protein evolution?

Studying SCaMC protein evolution requires integrative approaches:

  • Comparative genomic analysis:

    • Sequence comparison across species from Xenopus to humans

    • Analysis of gene structure and regulatory elements

    • Investigation of phylogenetic relationships between isoforms

  • Structure-function studies:

    • Identification of conserved vs. variable regions

    • Analysis of EF-hand domain conservation

    • Functional characterization of orthologues from different species

  • Expression pattern analysis:

    • Tissue distribution across species

    • Developmental regulation

    • Response to hormones and stress conditions

Xenopus laevis SCaMC-1-A (slc25a24-a) provides a valuable comparative model, with its 473-amino acid sequence sharing significant homology with human SCaMC-1 . Such cross-species analysis can reveal evolutionary constraints on calcium-binding domains versus carrier regions, illuminating which functional aspects are most critical for survival across vertebrate evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.