Recombinant Xenopus laevis Calcium-binding mitochondrial carrier protein SCaMC-2 (slc25a25)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

The Recombinant Xenopus laevis Calcium-binding Mitochondrial Carrier Protein SCaMC-2 (slc25a25) is a synthetic variant of the native protein encoded by the slc25a25 gene. It belongs to the Solute Carrier Family 25 (SLC25), a group of mitochondrial carrier proteins responsible for transporting metabolites, ions, and cofactors across mitochondrial membranes . SCaMC-2 is distinguished by its N-terminal extension containing calcium-binding EF-hand motifs and a C-terminal mitochondrial carrier domain, enabling calcium-dependent regulation of transport activity .

Gene and Protein Features

AttributeDetails
Gene Nameslc25a25 (Xenopus laevis), SLC25A25 (human ortholog)
Protein NameCalcium-binding mitochondrial carrier protein SCaMC-2
Alternative NamesSmall calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
Uniprot IDQ7ZYD5 (Xenopus laevis)
Molecular Weight~57 kDa (predicted)
Domain Structure- N-terminal: 4 EF-hand motifs (calcium-binding)
- C-terminal: Mitochondrial carrier domain (transport function)

Recombinant Production

The recombinant protein is produced in cell-free expression systems with ≥85% purity (SDS-PAGE validated) . Host systems include Xenopus tropicalis, human, rat, and zebrafish (Danio rerio) .

Mitochondrial Transport and Calcium Signaling

SCaMC-2 facilitates calcium-regulated mitochondrial transport, acting as a bridge between cytosolic calcium signals and mitochondrial function . Its EF-hand motifs allow direct interaction with cytosolic Ca²⁺, modulating transport activity without requiring mitochondrial calcium entry .

Splice Variants and Isoforms

The slc25a25 gene undergoes alternative splicing, generating four isoforms with variations in the N-terminal region (e.g., loss of 1–3 EF-hand motifs) . These isoforms may confer distinct calcium sensitivities, enabling fine-tuned regulation of mitochondrial processes .

Experimental Techniques

ApplicationDetails
ELISA (Enzyme-Linked Immunosorbent Assay)Detection of SCaMC-2 in tissue or cellular samples
Western BlotValidation of protein expression and purity in experimental models
Functional StudiesAnalysis of mitochondrial transport mechanisms and calcium-dependent regulation

Xenopus laevis as a Model Organism

Xenopus laevis is widely used in developmental biology due to its evolutionary conservation and ease of manipulation . SCaMC-2 studies in this model may elucidate its role in mitochondrial dynamics during embryogenesis, particularly in processes like gastrulation or neural development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate special requirements for the format. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, but customers can adjust based on their needs.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
slc25a25; scamc2; Calcium-binding mitochondrial carrier protein SCaMC-2; Small calcium-binding mitochondrial carrier protein 2; Solute carrier family 25 member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-514
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
slc25a25
Target Protein Sequence
MARPRSLVSPLLSGVFCQCDTVSGAPHSHETPASPSLAAAALAADPCGGLLCGGPEHERR LQILFQELDVNKDGAICINDLAVGLKRLGVHRTELELRKIVKAGDKDQDGQLDFDEFVHY LRDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDLGVNISEQQAEKILKSMDKNGTMTID WNEWRDYHLLHSAENIPEIILYWKHSTIFDVGENLLVPDEFTVEEKQTGMWWRHLVAGGG AGAVSRTCTAPLDRLKVLMQVHASRSNNMSILGGFTHMIREGGFRSLWRGNGINVIKIAP ESAIKFMAYEQIKRIIGSNQETLGIHERFVAGSLAGVIAQSSIYPMEVLKTRMALRKTGQ YQGVLDCGKKILLQEGLSAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYATSSADP GVFVLLACGTVSSTCGQLASYPLALVRTRMQAEASVEGAPQMTMSKLFKHIVKTEGAFGL YRGLAPNFMKVIPAVSISYVVYENLKLTLGVQSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier.
Database Links

KEGG: xla:380040

UniGene: Xl.5805

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A25 and what is its function in Xenopus laevis?

SLC25A25 encodes the ATP-Mg2+/Pi carrier 3 (APC3), also known as SCaMC-2 (short calcium-binding mitochondrial carrier 2), which belongs to the mitochondrial carrier family. In Xenopus laevis, as in other vertebrates, this protein mediates the transport of adenine nucleotides across the inner mitochondrial membrane in a calcium-dependent manner. The carrier is essential for regulating energy metabolism by facilitating the exchange of ATP-Mg2+ for phosphate between the mitochondrial matrix and the cytosol .

The gene shows expression across multiple tissues in Xenopus laevis, similar to how related genes such as δ-catenin show ubiquitous expression across adult Xenopus tissues . Functionally, SCaMC-2 responds to changes in cytosolic calcium concentration, which allows it to couple calcium signaling with mitochondrial energy production. This mechanism is particularly important during periods of high metabolic demand or cellular stress.

How is the SLC25A25 gene structure characterized in Xenopus laevis?

The Xenopus laevis SLC25A25 gene, like many genes in this tetraploid species, likely exists in multiple copies due to the pseudotetraploid nature of the X. laevis genome. Similar to other Xenopus genes that have been characterized, such as ribosomal protein genes that typically have 2-5 copies per haploid genome, SLC25A25 may also exist in multiple copies .

Alternative splicing appears to be a common feature of genes in the p120-catenin subfamily in Xenopus, as demonstrated by the δ-catenin gene which exhibits multiple splicing variants (A, B, and C) that have not been reported in mammals . By analogy, SLC25A25 in Xenopus laevis likely undergoes similar alternative splicing events that generate multiple protein isoforms with potentially distinct functional attributes.

The gene structure typically includes:

  • Multiple exons that can undergo alternative splicing

  • Conserved regions encoding the mitochondrial carrier domain

  • Calcium-binding motifs in the N-terminal region

  • Regulatory elements controlling tissue-specific expression

What techniques are used to isolate and study recombinant Xenopus laevis SCaMC-2?

Recombinant expression and purification of Xenopus laevis SCaMC-2 typically follows these methodological approaches:

  • cDNA Cloning and Sequence Verification:

    • mRNA isolation from Xenopus laevis tissues, typically oocytes or embryos

    • Reverse transcription to generate cDNA

    • PCR amplification using specific primers designed based on reference sequences

    • Cloning into expression vectors such as pBR322 or modern equivalents

    • Sequence verification against reference databases (NCBI, Xenbase)

  • Recombinant Expression Systems:

    • Bacterial expression (E. coli) for basic structural studies

    • Eukaryotic expression systems (yeast, insect cells) for functional studies

    • Cell-free systems for rapid protein production

  • Purification Techniques:

    • Affinity chromatography using histidine or other fusion tags

    • Ion exchange chromatography

    • Size exclusion chromatography for final purification and buffer exchange

  • Functional Characterization:

    • Reconstitution into liposomes for transport assays

    • Calcium-binding assays using fluorescent indicators or isothermal titration calorimetry

    • ATP transport assays to measure carrier activity

Similar methodologies have been successfully applied to study other Xenopus mitochondrial proteins, such as the 31 kDa DNA binding protein isolated from oocyte mitochondria .

What are the key structural features of calcium-binding mitochondrial carrier protein SCaMC-2?

SCaMC-2 exhibits a bipartite structure consisting of:

  • N-terminal Domain:

    • Contains EF-hand calcium-binding motifs (typically 4-5 EF-hands)

    • Regulates carrier activity through conformational changes in response to calcium binding

    • Extends into the intermembrane space of mitochondria

    • Acts as the calcium sensor for the protein

  • C-terminal Domain:

    • Contains six transmembrane α-helices forming the characteristic mitochondrial carrier fold

    • Creates the substrate translocation pathway across the inner mitochondrial membrane

    • Includes conserved signature motifs typical of mitochondrial carriers

    • Forms the actual transport channel for ATP-Mg2+/Pi exchange

The binding of calcium to the EF-hand motifs induces conformational changes that propagate to the C-terminal domain, thereby regulating transport activity. Modeling studies suggest that sequence variations, such as the p.Gln349His variant identified in humans, can disrupt conserved polar interactions, potentially causing structural instability and reduced calcium-regulated ATP transport (reduced to approximately 20% of normal activity) .

How does calcium regulation affect the transport activity of SCaMC-2 in Xenopus laevis?

The calcium regulation of SCaMC-2 transport activity involves a sophisticated mechanism:

  • Calcium Sensing Mechanism:

    • Calcium ions bind to the EF-hand motifs in the N-terminal domain with different affinities

    • This binding triggers conformational changes that propagate to the carrier domain

    • The calcium concentration threshold for activation is typically in the micromolar range

    • The calcium-binding properties may differ between SCaMC-2 isoforms generated by alternative splicing

  • Transport Kinetics:

    • In the absence of calcium, SCaMC-2 exhibits minimal transport activity

    • Calcium binding increases the Vmax of transport without significantly affecting substrate affinity

    • The degree of activation is concentration-dependent, with maximal activation occurring at physiological calcium concentrations during cellular signaling events

  • Physiological Significance:

    • This calcium regulation couples cytosolic calcium signaling to mitochondrial energy metabolism

    • During periods of high calcium signaling (e.g., muscle contraction, neuronal activity), increased ATP-Mg2+ import into mitochondria enhances energy production

    • Variants that affect calcium regulation, like the p.Gln349His mutation, can significantly impair this regulatory mechanism, reducing transport activity to approximately 20% of normal levels

This regulatory mechanism represents an important adaptation that allows Xenopus laevis cells to rapidly adjust mitochondrial metabolism in response to changing energy demands.

What are the implications of SLC25A25 gene knockout studies for understanding SCaMC-2 function?

Gene knockout studies of SLC25A25, primarily conducted in mice, have provided valuable insights applicable to understanding SCaMC-2 function in Xenopus laevis:

  • Phenotypic Effects:

    • SLC25A25-knockout mice show reduced metabolic efficiency

    • These mice exhibit enhanced resistance to diet-induced obesity

    • They also demonstrate impaired exercise performance

    • These findings suggest that SCaMC-2 plays a crucial role in energy homeostasis and metabolic adaptation

  • Molecular Consequences:

    • Generation of SLC25A25-knockout models involves introducing loxP sites into introns flanking critical exons

    • Cre-mediated recombination leads to deletion of these exons, disrupting gene function

    • The effectiveness of gene deletion can be verified through genomic PCR and RT-PCR analysis

  • Experimental Design for Xenopus Studies:

    • For Xenopus laevis, CRISPR/Cas9 genome editing can be employed to generate knockout models

    • This approach takes advantage of the well-established transgenic techniques available for Xenopus

    • The availability of stock centers such as the National Xenopus Resource (NXR) and the European Xenopus Resource Centre (EXRC) facilitates access to genetic tools

ParameterWild-TypeSLC25A25 KnockoutFunctional Implication
Metabolic efficiencyNormalReducedSCaMC-2 is required for optimal energy utilization
Response to high-fat dietWeight gainResistance to obesitySCaMC-2 influences lipid metabolism
Exercise capacityNormalImpairedSCaMC-2 is essential for sustained physical activity
ATP transport activity100%AbsentComplete loss of carrier-mediated ATP-Mg2+/Pi exchange

How do mutations in SLC25A25 affect mitochondrial function and calcium homeostasis?

Mutations in SLC25A25 can significantly impact mitochondrial function through several mechanisms:

  • Transport Activity Impairment:

    • The p.Gln349His variant identified in humans with kidney stones reduces calcium-regulated ATP transport to approximately 20% of normal activity

    • Structural modeling suggests that this variant lacks a conserved polar interaction, potentially causing structural instability

    • Similar mutations could affect the Xenopus laevis SCaMC-2, altering its ability to transport ATP-Mg2+ in response to calcium signals

  • Calcium Signaling Disruption:

    • Mutations in calcium-binding EF-hand motifs can alter the calcium sensitivity of the carrier

    • This disruption may lead to inappropriate activation or inhibition of ATP-Mg2+ transport

    • Consequently, the link between cytosolic calcium signaling and mitochondrial energy metabolism becomes compromised

  • Metabolic Consequences:

    • Impaired ATP-Mg2+/Pi exchange affects the adenine nucleotide pool within mitochondria

    • This alteration can influence the activity of ATP-dependent processes in the mitochondrial matrix

    • Ultimately, the cell's ability to respond to changing energy demands becomes limited

Experimental approaches to study these effects include:

  • Site-directed mutagenesis to introduce specific mutations

  • Functional reconstitution of mutant carriers in liposomes

  • Metabolic flux analysis to assess the impact on cellular energy metabolism

  • Calcium imaging to evaluate effects on calcium homeostasis

What experimental approaches can be used to study the interaction between SCaMC-2 and other mitochondrial proteins?

Several sophisticated experimental approaches can be employed to investigate the interactions between SCaMC-2 and other mitochondrial proteins:

  • Proteomics-Based Approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Cross-linking mass spectrometry (XL-MS) to capture transient interactions

    • These techniques can identify proteins that physically interact with SCaMC-2 or exist in close proximity within the mitochondrial membrane

  • Imaging Techniques:

    • Förster resonance energy transfer (FRET) to visualize protein-protein interactions in live cells

    • Super-resolution microscopy to map the spatial organization of SCaMC-2 relative to other mitochondrial proteins

    • These approaches leverage the advantages of Xenopus tissues and cell cultures, which are ideal for long periods of live imaging

  • Functional Interaction Studies:

    • Co-expression and co-depletion experiments to identify functional relationships

    • Electrophysiological measurements in reconstituted systems

    • Mitochondrial respiration assays to assess functional coupling

  • Genetic Approaches:

    • CRISPR/Cas9-mediated genome editing to introduce tags or mutations

    • Transgenic Xenopus lines expressing fluorescently tagged proteins

    • These genetic tools are particularly accessible for Xenopus laevis, as evidenced by the continuous update of genetic and genomic resources and the availability of transgenic lines from resource centers

By combining these approaches, researchers can build a comprehensive picture of how SCaMC-2 integrates into the wider mitochondrial protein network and how these interactions influence its function in calcium-regulated ATP transport.

How can Xenopus laevis SCaMC-2 be used as a model for human mitochondrial disorders?

Xenopus laevis SCaMC-2 serves as an excellent model for studying human mitochondrial disorders due to several advantages:

  • Evolutionary Conservation:

    • High sequence identity between Xenopus and human SCaMC-2 proteins

    • Conserved functional domains and regulatory mechanisms

    • Disease-relevant mutations can be modeled in the Xenopus protein to study their effects

  • Experimental Advantages:

    • The ability to manipulate Xenopus embryos at early developmental stages

    • High fecundity producing large numbers of embryos for statistical analysis

    • Established techniques for gene expression modification using antisense morpholino oligonucleotides and CRISPR/Cas9 genome editing

  • Disease Modeling:

    • Human disease variants, such as the p.Gln349His mutation associated with kidney stones, can be introduced into Xenopus SCaMC-2

    • The effects on calcium-regulated transport activity can be measured

    • The developmental and physiological consequences can be assessed in embryos and tadpoles

This approach has already yielded valuable insights in the case of the p.Gln349His variant, which reduces calcium-regulated ATP transport to approximately 20% of normal activity and is associated with kidney stone formation in humans .

How do post-translational modifications regulate SCaMC-2 function beyond calcium binding?

Beyond calcium regulation, SCaMC-2 function is likely modulated by various post-translational modifications:

  • Phosphorylation:

    • Potential phosphorylation sites in the N-terminal regulatory domain

    • Phosphorylation may alter calcium sensitivity or maximal transport activity

    • Kinases involved may include calcium/calmodulin-dependent protein kinases or protein kinase C

  • Oxidative Modifications:

    • Redox-sensitive cysteine residues may respond to changes in mitochondrial redox state

    • Oxidative modifications could provide a mechanism linking oxidative stress to altered ATP transport

    • This would allow for metabolic adaptation during periods of mitochondrial stress

  • Ubiquitination and Protein Stability:

    • Ubiquitination may regulate SCaMC-2 turnover and abundance

    • The half-life of the protein could be a regulatory point for long-term metabolic adaptation

    • Proteasome-mediated degradation pathways may target specific SCaMC-2 isoforms

Experimental approaches to study these modifications include:

  • Mass spectrometry-based proteomics to identify modification sites

  • Generation of modification-specific antibodies

  • Site-directed mutagenesis to create modification-resistant variants

  • In vitro enzymatic assays to characterize modification kinetics

What are the technical challenges in producing functional recombinant Xenopus SCaMC-2 for structural studies?

Producing functional recombinant Xenopus SCaMC-2 for structural studies presents several technical challenges:

  • Expression System Selection:

    • Bacterial expression often results in inclusion bodies requiring refolding

    • Eukaryotic expression systems may yield properly folded protein but at lower yields

    • Cell-free systems may offer a compromise but require optimization

  • Protein Stability Issues:

    • Membrane proteins like SCaMC-2 are often unstable when removed from the lipid bilayer

    • Detergent selection is critical for maintaining native structure and function

    • The bipartite nature of SCaMC-2 (with separate regulatory and carrier domains) adds complexity

  • Functional Verification:

    • Assessing calcium binding and transport activity requires reconstitution into artificial membranes

    • Ensuring that the recombinant protein maintains calcium regulation is essential

    • Activity assays must be sensitive enough to detect both basal and calcium-stimulated transport

  • Structural Determination Challenges:

    • Obtaining sufficient quantities of homogeneous, stable protein for crystallization

    • The dynamic nature of the carrier may complicate crystallization efforts

    • Cryo-EM approaches may be more suitable but require optimization for relatively small membrane proteins

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, low costOften forms inclusion bodiesUse fusion tags, low temperature induction
Insect cellsBetter folding, post-translational modificationsLower yield, higher costOptimize codon usage, use strong promoters
YeastEukaryotic processing, higher yield than mammalian cellsMay not reproduce all modificationsScreen multiple yeast strains
Cell-free systemsRapid, overcomes toxicity issuesExpensive, limited scaleSupplement with lipids and chaperones

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.