Recombinant Xenopus laevis Calcium release-activated calcium channel protein 1 (orai1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Recombinant Xenopus laevis Orai1 is expressed in E. coli systems, yielding a full-length protein spanning residues 1–258 (UniProt ID: Q5EAU0) . The protein is tagged for purification (commonly His or GST tags) and stored in lyophilized or glycerol-containing buffers to maintain stability. Key specifications include:

ParameterDetails
Expression HostEscherichia coli
TagDetermined during production (commonly His, GST, or Avi)
Purity>90% (verified by SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose or 50% glycerol
ReconstitutionDeionized water; glycerol (5–50%) recommended for long-term storage
Sequence258 amino acids, including conserved transmembrane domains

2.1. Sequence and Domains

The Xenopus Orai1 sequence (MYPECGVETK...HYA) shares homology with mammalian Orai1, including:

  • Transmembrane helices (M1–M4): Critical for channel pore formation .

  • Coiled-coil domains: Mediate interaction with STIM1, the calcium sensor in the endoplasmic reticulum .

  • Selectivity filter: A conserved acidic region (e.g., E106 in Drosophila) ensures Ca²⁺ selectivity .

2.2. Activation Mechanism

Orai1 activation requires STIM1 binding upon ER calcium depletion. Key steps include:

  1. STIM1 oligomerization exposes a cytosolic domain (CAD/SOAR) .

  2. Intramolecular clamp release: Acidic residues in STIM1’s coiled-coil domain disengage, enabling interaction with Orai1’s basic residues .

  3. Channel opening: Pore dilation (∼6 Å in Drosophila Orai1) permits Ca²⁺ influx .

Pathogenic mutations (e.g., H206A in Drosophila) induce constitutive activity, bypassing STIM1 regulation .

3.1. Calcium Signaling in Development

  • Xenopus oocyte maturation: Orai1-mediated SOCE regulates meiotic exit post-fertilization, with calcium transients (∼1 µM) triggering cyclin B degradation via CaMKII and calcineurin .

  • Cardiac hypertrophy: Orai1 deficiency in mice exacerbates pressure overload-induced dilated cardiomyopathy, linking SOCE to cardiac compensation .

3.2. Immune Modulation

  • T-cell activation: Orai1 facilitates NFAT signaling, but sodium influx through dysfunctional channels (e.g., in α-SNAP-deficient cells) disrupts mTORC2 and ATP levels, impairing regulatory T-cell differentiation .

3.3. Pharmacological Studies

  • CRAC inhibitors: Compounds targeting Orai1’s pore (e.g., GSK-7975A) are explored for autoimmune diseases .

Challenges and Future Directions

  • Species-specific differences: Xenopus Orai1’s lower homology to human orthologs (∼60%) limits direct translational insights .

  • Selectivity mechanisms: Resolving how non-specific cation permeation (e.g., Na⁺ in α-SNAP mutants) alters signaling nodes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference for your preparation.
Shelf Life
The shelf life of our proteins is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please specify it and we will prioritize its inclusion in the development process.
Synonyms
orai1; tmem142a; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MYPECGVETKSRPCSKQLQEEVSYPEWISRSYVELMSLNEHSMQALSWRKLYLSRAKLKA SSRTSALLSGFAMVAMVEVQLEPNHAYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNI EAVSNVHNLNSVKESPHERMHHHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPVNSPKIS SNETSAVSSGQAAAITSTAIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAELAQL QDQLDHRGDPVQSPVHYA
Uniprot No.

Target Background

Function
This protein is a subunit of the Ca(2+) release-activated Ca(2+) (CRAC) channel, which mediates Ca(2+) influx following the depletion of intracellular Ca(2+) stores.
Database Links

KEGG: xla:734537

UniGene: Xl.53899

Protein Families
Orai family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Orai1 and what is its fundamental role in Xenopus laevis?

Orai1 is a critical plasma membrane calcium channel protein that mediates store-operated calcium entry (SOCE) in Xenopus laevis oocytes. It functions as the primary conducting unit of the calcium release-activated calcium (CRAC) channel, forming the pore through which calcium enters the cell following depletion of intracellular calcium stores. In the Xenopus system, Orai1 localizes predominantly to the plasma membrane in immature oocytes where it plays an essential role in calcium signaling pathways . The channel is activated through a complex mechanism involving STIM1 (Stromal Interaction Molecule 1), an endoplasmic reticulum (ER) calcium sensor that oligomerizes and translocates to ER-plasma membrane junctions upon store depletion, where it directly interacts with and activates Orai1 .

Why are Xenopus oocytes considered an ideal model system for studying SOCE?

Xenopus oocytes provide several significant advantages as a model system for studying SOCE:

  • Large size: Their diameter of ~1mm facilitates microinjection of RNA and protein, and enables clear visualization of subcellular compartments .

  • Distinct visualization: The large cell size allows for clear separation and imaging of plasma membrane and ER compartments .

  • Electrophysiological accessibility: Their size permits reliable electrophysiological recordings of the small-amplitude SOCE currents (ISOC) .

  • Natural maturation process: Oocytes undergo a physiological transition to eggs, providing a natural system to study SOCE regulation during cell cycle progression .

  • Protein expression system: They efficiently translate injected RNA, allowing for controlled expression of wild-type and mutant proteins .

These characteristics have made Xenopus oocytes instrumental in elucidating the molecular mechanisms of SOCE, including the identification of key functional domains in both STIM1 and Orai1 proteins .

How can recombinant Orai1 be expressed in Xenopus oocytes?

Expression of recombinant Orai1 in Xenopus oocytes involves a methodical process:

  • Molecular cloning: The Orai1 gene is inserted into an oocyte expression vector such as pSGEM .

  • RNA synthesis: In vitro transcription is performed using T7 RNA polymerase with T7 mMESSAGE mMACHINE kit .

  • Microinjection: 1-2 ng of synthesized RNA is injected into defolliculated stage V-VI oocytes .

  • Expression period: Oocytes are incubated for 2-3 days at 18°C to allow for protein expression .

  • Verification: Expression can be confirmed using GFP-tagged constructs through confocal microscopy or by Western blotting .

The expressed recombinant protein is correctly trafficked to the plasma membrane and remains functional, as evidenced by its ability to form clusters with STIM1 upon store depletion and activate SOCE currents .

What techniques can be used to visualize STIM1-Orai1 interactions in Xenopus oocytes?

Several advanced imaging techniques can be employed to visualize STIM1-Orai1 interactions:

  • Confocal microscopy: Using fluorescently tagged proteins (e.g., mCherry-STIM1 and GFP-Orai1), researchers can capture z-stack images (typically at 0.5 μm intervals) to visualize protein localization before and after store depletion .

  • Orthogonal reconstructions: These provide cross-sectional views of the oocyte, clearly showing the spatial relationship between membrane-localized Orai1 and ER-resident STIM1 .

  • FRET analysis: Förster Resonance Energy Transfer can detect close interactions between STIM1 and Orai1, with increased FRET signals observed following store depletion .

  • Rapamycin-induced oligomerization: This technique uses the FRB-FKBP system to induce artificial clustering of STIM1 cytosolic domains, allowing researchers to study the consequences of STIM1 oligomerization on Orai1 activation .

The visualization protocol typically involves:

  • Setting the confocal pinhole aperture to 1 Airy unit

  • Capturing images at both the plasma membrane plane (maximum GFP-Orai1 expression) and deeper ER planes (maximum STIM1 expression)

  • Comparing protein distribution before and after treatment with store-depleting agents like TPEN (5 mM) or IP3

What molecular mechanism underlies STIM1-mediated activation of Orai1?

The activation of Orai1 by STIM1 involves a sophisticated intramolecular switch mechanism:

  • Intramolecular silencing: In resting STIM1, the CAD/SOAR (CRAC Activation Domain/STIM1 Orai1 Activation Region) domain is maintained in an inactive state through an intramolecular interaction between an acidic region in the first coiled-coil domain and a basic region within CAD/SOAR .

  • Electrostatic interaction: Specifically, three glutamate residues in the acidic segment form an electrostatic interaction with four lysine residues in the basic segment of CAD/SOAR .

  • Activation mechanism: Upon store depletion, STIM1 oligomerizes, disrupting this intramolecular clamp and exposing the basic region of CAD/SOAR .

  • Orai1 binding: The exposed basic region of CAD/SOAR then interacts with the C-terminal domain of Orai1, leading to channel opening .

This was demonstrated through mutational analysis where neutralizing the acidic segment (3EA or 4EA mutations) resulted in constitutively active STIM1, while mutations in the basic region (4K/AGAG) prevented Orai1 activation .

STIM1 DomainKey ResiduesFunction in Activation
Acidic segmentThree glutamate residues (E)Forms intramolecular clamp with basic region
CAD/SOAR basic regionFour lysine residues (K)Essential for Orai1 binding and activation
CAD/SOAR (a.a. 315-462)-Sufficient for Orai1 activation without oligomerization

How does Orai1 trafficking change during Xenopus oocyte maturation?

Orai1 undergoes dramatic trafficking changes during oocyte maturation that directly impact SOCE function:

  • Immature oocytes: Orai1 primarily localizes to the plasma membrane, with some cycling between the membrane and endosomal compartments .

  • During maturation: Orai1 is progressively internalized from the plasma membrane into an endosomal compartment that is positive for caveolin .

  • Mature eggs: Orai1 is predominantly found in late endosomal compartments (positive for Caveolin, Rab5, Rab7, and Rab9), with minimal plasma membrane localization .

This internalization process is:

  • Directly correlated with SOCE inactivation during meiosis

  • Dependent on MPF (Maturation Promoting Factor) activation

  • Not associated with Orai1 degradation, as protein levels remain constant

  • Part of a general decrease in cell membrane surface area during maturation

The internalization mechanism involves caveolin-mediated endocytosis, as demonstrated by colocalization studies showing Orai1 trafficking with caveolin . This process can be experimentally manipulated using dominant-negative SNAP-25 mutants (SNAP25Δ20) to block exocytosis, which shifts Orai1 distribution to endosomal compartments even in immature oocytes .

What experimental approaches can be used to study the functional domains of Orai1 in Xenopus oocytes?

Researchers can employ several sophisticated experimental approaches to study Orai1 functional domains:

  • Site-directed mutagenesis: Key residues in Orai1 can be mutated (using QuickChange mutagenesis) to investigate their role in channel function, trafficking, and interaction with STIM1 .

  • Truncation analysis: Generation of Orai1 fragments to identify minimal regions required for membrane targeting, STIM1 binding, and channel activity .

  • Electrophysiological measurements: Two-electrode voltage clamp recordings can measure SOCE currents (ISOC) in oocytes expressing wild-type or mutant Orai1 constructs .

  • Domain swapping: Creating chimeric constructs between Orai1 and other proteins to identify critical functional domains .

  • Inducible protein-protein interaction systems: Using rapamycin-inducible multimerization systems to trigger interactions between specific domains of STIM1 and Orai1 .

  • Biochemical assays: Co-immunoprecipitation and Western blotting to analyze protein-protein interactions and phosphorylation states .

  • Trafficking studies: Using blockers of exocytosis (SNAP25Δ20) or endocytosis to manipulate Orai1 surface expression and analyze the dynamics of protein trafficking .

These approaches have been instrumental in determining that distinct regions of Orai1 are responsible for its correct membrane targeting, interaction with STIM1, and formation of functional calcium-selective channels .

What distinguishes Orai1-mediated calcium currents from TRPC1-mediated currents in Xenopus?

Orai1 and TRPC1 contribute to distinct calcium currents with different biophysical and molecular properties:

  • Current identity:

    • Orai1/STIM1 mediates the highly calcium-selective ICRAC (calcium release-activated calcium current)

    • TRPC1/STIM1 mediates a non-selective cation current

  • Channel properties:

    • ICRAC (Orai1): Highly calcium-selective, inwardly rectifying, with a very small conductance

    • TRPC1 current: Non-selective among cations, with larger conductance

  • Activation requirements:

    • Both channels require store depletion and STIM1

    • SOAR domain of STIM1 can activate Orai1 but not TRPC1

    • STIM1(684EE685) mutation prevents TRPC1 gating without affecting Orai1 activation

  • Current summation:

    • The total ISOC recorded in Xenopus oocytes represents a sum of Orai1/STIM1-mediated ICRAC and the larger TRPC1/STIM1-mediated non-selective current

    • Suppression of TRPC1 function (via shTRPC1 or STIM1 mutations) unmasks the underlying Orai1-mediated ICRAC

These findings provide strong evidence that Orai1 and TRPC1 form separate channel entities rather than contributing to the same channel pore or having Orai1 function merely as a regulatory subunit of TRPC channels .

How does calcium entry via Orai1 regulate plasma membrane remodeling?

Calcium entry through Orai1 channels plays a crucial role in regulating plasma membrane remodeling through a complex feedback mechanism:

  • TRPC1 trafficking: Ca²⁺ entry via Orai1 triggers plasma membrane insertion of TRPC1 channels .

  • Dependence on SOCE: This insertion process is prevented by blocking SOCE with 1 μM Gd³⁺ or removal of extracellular calcium, confirming the requirement for Orai1-mediated calcium entry .

  • Signaling cascade: The calcium influx through Orai1 initiates signaling pathways that promote exocytosis of TRPC1-containing vesicles to the plasma membrane .

  • Functional consequence: This represents a positive feedback mechanism where initial calcium entry via Orai1 leads to increased surface expression of TRPC1, further enhancing calcium influx capacity .

  • Physiological relevance: This mechanism may be particularly important during cellular processes requiring sustained calcium signals, such as during fertilization .

This regulatory mechanism highlights the intricate interplay between different calcium channel types and demonstrates that Orai1 not only contributes directly to calcium entry but also controls the surface expression of other calcium-permeable channels .

What protocol should be followed to visualize Orai1 internalization during meiosis?

To visualize Orai1 internalization during meiosis, researchers should follow this detailed protocol:

  • Preparation of oocytes:

    • Inject oocytes with 1-2 ng of RNA coding for GFP-Orai1 (with or without co-expression of other proteins like STIM1)

    • Allow 2-3 days for protein expression

  • Induction of maturation:

    • Incubate oocytes with progesterone (2 μg/ml) overnight at 18°C

    • Verify maturation by the appearance of a white spot at the animal pole

  • Imaging preparation:

    • Mount both immature oocytes (control) and mature eggs in the same chamber

    • Maintain in OR2 medium during imaging

  • Confocal microscopy:

    • Capture z-stack images with 0.5-1 μm intervals

    • Record both the plasma membrane plane and deeper intracellular planes (10-15 μm depth)

    • Create orthogonal reconstructions to visualize protein distribution across the cell

  • Analysis:

    • Compare the distribution of Orai1-GFP between oocytes and eggs

    • Quantify the fluorescence intensity at different depths

    • Identify the endosomal compartment containing internalized Orai1

  • Co-localization studies (optional):

    • Co-express Orai1 with markers for different endosomal compartments (e.g., mCherry-tagged caveolin)

    • Assess the degree of co-localization to identify the specific vesicular compartment

This approach will clearly demonstrate the shift in Orai1 localization from predominantly plasma membrane in oocytes to primarily endosomal in eggs, correlating with the loss of SOCE during meiotic maturation .

How can electrophysiological measurements of Orai1 currents be performed in Xenopus oocytes?

Electrophysiological recording of Orai1-mediated currents in Xenopus oocytes requires a precise methodology:

  • Oocyte preparation:

    • Inject oocytes with RNA encoding Orai1 and STIM1 (1-5 ng each)

    • Allow 2-3 days for expression at 18°C

  • Store depletion methods:

    • Internal injection of IP3 (500 μM final concentration)

    • Bath application of thapsigargin (1 μM)

    • Inclusion of EGTA (20 mM) in the recording electrode

  • Two-electrode voltage clamp configuration:

    • Use microelectrodes filled with 3M KCl (resistance 0.5-1.5 MΩ)

    • Hold voltage at -40 to -60 mV

    • Apply voltage ramps (-100 to +100 mV over 1 second) every 5-10 seconds

  • Recording solutions:

    • Standard solution: 96 mM NaCl, 2.5 mM KCl, 10 mM HEPES (pH 7.4)

    • For ISOC measurement: 5 mM CaCl2 (5Ca solution)

    • Ca2+-free solution: Standard solution plus 2 mM MgCl2, 0.5 mM EGTA

  • Current analysis:

    • ISOC is identified as the inward current developing after store depletion

    • Verify by showing Ca2+ dependence (removal of external Ca2+ should abolish current)

    • Confirm with pharmacological blockers (e.g., 1 μM Gd3+)

  • Data interpretation:

    • Current amplitude: Measured at -80 or -100 mV

    • Current-voltage relationship: Should show inward rectification for Orai1-mediated ICRAC

    • Time course: Typically develops over 5-10 minutes after store depletion

This approach allows for reliable recording of the relatively small SOCE currents and can distinguish between Orai1-mediated ICRAC and TRPC1-mediated non-selective currents .

What mutational strategies can be employed to study STIM1-Orai1 interactions?

Several mutational strategies have proven effective for investigating STIM1-Orai1 interactions:

  • Charge neutralization mutations:

    • In STIM1's acidic segment: Mutating glutamate residues to alanine (3EA or 4EA) disrupts the intramolecular clamp, creating constitutively active STIM1

    • In CAD/SOAR's basic region: Mutating lysine residues to alanine (4K/AGAG) prevents Orai1 activation

  • Domain truncation and isolation:

    • Expression of isolated CAD/SOAR domain (amino acids 315-462), which is constitutively active and sufficient to activate Orai1

    • Construction of truncated STIM1 fragments to identify minimal regions required for function

  • Inducible clustering systems:

    • FRB-FKBP rapamycin-inducible system to trigger oligomerization of STIM1 cytosolic domains

    • This approach demonstrated that oligomerization of full cytoplasmic STIM1 segments is sufficient for activation

  • Point mutations in Orai1:

    • Mutating the leucine residue in Orai1 that corresponds to the leucine in STIM1 necessary for activation

    • Creating mutations in Orai1's C-terminal domain to disrupt STIM1 binding

  • Chimeric proteins:

    • Swapping domains between STIM1 and other proteins to identify critical interaction regions

    • Creating fusion proteins that force interaction between specific domains

Each of these approaches has contributed to our current understanding of the molecular mechanism of STIM1-Orai1 interaction, revealing that STIM1 activation involves release of an intramolecular clamp allowing the CAD/SOAR domain to interact with and activate Orai1 .

How can researchers resolve common issues when expressing recombinant Orai1 in Xenopus oocytes?

When working with recombinant Orai1 in Xenopus oocytes, researchers may encounter several challenges that can be addressed with specific troubleshooting strategies:

  • Poor protein expression:

    • Verify RNA quality by gel electrophoresis

    • Optimize RNA concentration (typically 1-5 ng)

    • Extend expression time to 3-4 days

    • Check for premature protein degradation by Western blotting at different time points

  • Abnormal trafficking:

    • Ensure the fluorescent tag does not interfere with trafficking by comparing different tag positions

    • Verify proper folding by including chaperone proteins

    • Co-express with STIM1 to stabilize Orai1 at the plasma membrane

  • Non-functional protein:

    • Confirm store-depletion protocol is effective (try multiple methods)

    • Verify expression of both Orai1 and STIM1 in the same oocyte

    • Test different ratios of Orai1:STIM1 (overexpression of Orai1 alone can inhibit endogenous SOCE)

  • High background currents:

    • Select healthy oocytes (stage V-VI) with uniform pigmentation

    • Maintain consistent temperature during recordings (18-22°C)

    • Block endogenous currents with appropriate channel blockers

    • Use leak subtraction protocols during electrophysiological recording

  • Poor visualization:

    • Optimize confocal settings (pinhole size, laser power, detector gain)

    • Image at the correct focal plane (plasma membrane for Orai1)

    • Use fresh oocytes (autofluorescence increases with age)

    • Apply minimal laser power to prevent photobleaching during extended imaging

These strategies should help ensure reliable expression and functional analysis of recombinant Orai1 in the Xenopus oocyte system .

How should contradictory data regarding Orai1 function be interpreted and resolved?

When facing contradictory data in Orai1 research, a systematic approach to interpretation and resolution is essential:

  • Methodological differences:

    • Compare experimental conditions (expression levels, recording solutions, store depletion methods)

    • Assess differences in protein tags (size, position, and type of tag can affect function)

    • Evaluate time points of measurement (SOCE properties change during oocyte maturation)

  • Model system variations:

    • Consider differences between Xenopus oocytes and mammalian cells

    • Account for endogenous proteins that may contribute to or modify Orai1 function

    • Verify findings across multiple model systems

  • Technical approach:

    • For discrepancies between imaging and electrophysiology data, perform both techniques on the same sample

    • Use complementary approaches (e.g., biochemical analysis alongside functional studies)

    • Implement concentration-response experiments rather than single-point measurements

  • Data integration:

    • Develop a working model that accommodates seemingly contradictory findings

    • Consider that Orai1 may have multiple activation modes or regulatory mechanisms

    • Propose experiments specifically designed to resolve the contradiction

  • Resolution strategies:

    • Generate and test Orai1 mutants that specifically address the contradiction

    • Manipulate experimental conditions to determine when each conflicting result occurs

    • Collaborate with groups reporting contradictory findings to directly compare protocols

An example from the literature involved resolving contradictions about whether Orai1 and TRPC1 form a single channel or separate entities. This was conclusively addressed by showing that suppression of TRPC1 function unmasks Orai1-mediated ICRAC, demonstrating they are distinct channels with different properties .

What are emerging areas of investigation for Orai1 in Xenopus laevis research?

Several promising research directions are emerging in the field of Xenopus Orai1 research:

  • Structural biology integration:

    • Combining cryo-EM structural data of mammalian Orai1 with functional studies in Xenopus

    • Using structure-guided mutagenesis to precisely map functional domains

    • Testing predictions from computational modeling of channel gating

  • Regulatory mechanisms:

    • Investigating post-translational modifications of Orai1 (phosphorylation, glycosylation)

    • Exploring cell-cycle dependent regulation beyond meiosis

    • Identifying novel binding partners that modulate Orai1 function

  • Developmental biology applications:

    • Examining the role of Orai1 throughout Xenopus embryonic development

    • Investigating tissue-specific Orai1 functions using targeted approaches

    • Exploring Orai1's role in calcium oscillations during early development

  • Advanced imaging technologies:

    • Implementing super-resolution microscopy to visualize nanoscale organization

    • Using optogenetic approaches to precisely control Orai1 activation

    • Developing FRET-based sensors to monitor Orai1 conformational changes in real-time

  • Comparative physiology:

    • Comparing properties of Xenopus Orai1 with mammalian orthologs

    • Investigating evolutionary conservation of regulatory mechanisms

    • Identifying species-specific features that may reveal new functional insights

These emerging areas hold significant potential for advancing our understanding of Orai1 function and regulation, with implications extending beyond the Xenopus model system to broader calcium signaling mechanisms across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.