Recombinant Xenopus laevis Corticotropin-releasing factor receptor 1 (crhr1)

Shipped with Ice Packs
In Stock

Description

Ligand Binding and Selectivity

Xenopus crhr1 exhibits distinct ligand-binding properties compared to mammalian orthologs:

LigandXenopus CRF-R1 (K<sub>D</sub> or K<sub>i</sub>)Human CRF-R1 (K<sub>D</sub> or K<sub>i</sub>)
Human/rat CRF1.2–2.8 nM 1.5 nM
Sauvagine51.4 nM 0.7 nM
Urocortin 11.2 nM 0.3 nM
Ovine CRF31.7 nM 1.1 nM

Key determinants of ligand selectivity include residues 70–89 in the N-terminal domain. Mutagenesis studies show that substitutions at positions 76 (Arg→Gln), 81 (Asn→Gly), and 83 (Gly→Val) in Xenopus crhr1 reduce sauvagine affinity by 10–22-fold .

crhr1 activates cAMP-dependent pathways via G<sub>αs</sub> coupling, influencing:

  • Neural stem cell maintenance: CRHR1/CREB/REST signaling promotes stemness by upregulating REST, a transcriptional repressor of neuronal differentiation .

  • Stress adaptation: Mediates corticotropin release in response to hypothalamic CRH .

  • Ligand-induced regulation: Prolonged CRF exposure downregulates receptor mRNA in pituitary cells but upregulates it in transfected HEK293 cells .

Comparative Analysis with Mammalian Receptors

Xenopus crhr1 diverges functionally from human CRF-R1:

  • Ligand selectivity: 10-fold lower affinity for sauvagine compared to human CRF-R1 .

  • Structural motifs: The N-terminal domain (residues 70–89) governs species-specific ligand preferences .

  • Tissue expression: Predominantly expressed in brain and heart in Xenopus, unlike broader mammalian distribution .

Research and Therapeutic Applications

  • Neurodevelopmental studies: Used to investigate CRHR1/REST axis in embryonic brain development .

  • Drug discovery: Serves as a model for designing selective CRF receptor antagonists for anxiety and depression .

  • Evolutionary biology: Highlights functional divergence between amphibian and mammalian stress-response systems .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
crhr1; crf1; Corticotropin-releasing factor receptor 1; CRF-R-1; CRF-R1; CRFR-1; Corticotropin-releasing hormone receptor 1; CRH-R-1; CRH-R1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-415
Protein Length
Full Length of Mature Protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
SLQDQCETLQHNSNFTGLACNASIDMIGTCWPSTAAGQMVARPCPEYFHGVQYNTTGNVY RECHLNGSWAGRGDYAQCQEILKQEKKTKVHYHIAIVINFLGHSISLCALLVAFILFLRL RSIRCLRNIIHWNLITAFILRNVTWFVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFF WMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKA GVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLG ITYMLFFVTPGEDEISRIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDK HSIRARVARAMSIPTSPTRISFHSIKQSSAI
Uniprot No.

Target Background

Function
The corticotropin-releasing factor receptor 1 (CRHR1) is a G-protein coupled receptor with high affinity for corticotropin-releasing factor (CRF) and urocortin (UCN). Ligand binding induces a conformational change, triggering signaling through guanine nucleotide-binding proteins (G proteins) and downstream effectors such as adenylate cyclase. This ultimately leads to increased intracellular cAMP levels.
Gene References Into Functions
  1. CRF expression in tadpole tails is upregulated by environmental stressors and exhibits cytoprotective effects. PMID: 16322064
Database Links

KEGG: xla:373580

UniGene: Xl.52

Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus laevis CRHR1?

Xenopus laevis CRHR1 (xCRF-R1) belongs to the secretin subfamily of G protein-coupled receptors (GPCRs). Like other Class B1 GPCRs, xCRF-R1 contains a distal N-terminal extracellular domain (ECD) that specifically selects and binds ligands, and a C-terminal tail that activates specific kinases to mediate signaling cascades. The receptor features seven transmembrane domains which are highly conserved. The N-terminal domain contains a short consensus repeat fold (ECD) which is characteristic of class B1 GPCRs and critical for docking peptides and binding-related agonists and antagonists . Unlike the non-selective human CRHR1, xCRF-R1 exhibits strong ligand selectivity despite sharing over 80% amino acid identity with the human receptor.

How does xCRF-R1 differ functionally from mammalian CRHR1?

The most notable functional difference between xCRF-R1 and mammalian CRHR1 is its ligand selectivity. While mammalian CRHR1 binds CRF from different species and related analogs (urocortin, urotensin I, sauvagine) with similar affinity, xCRF-R1 exhibits distinct preferences. It binds human/rat CRF, Xenopus CRF, urotensin I, and urocortin with significantly higher affinity than ovine CRF and sauvagine . This selectivity has been traced to specific amino acid differences in the N-terminal domain, particularly in positions 76, 81, 83, 88, and 89. Functionally, when activated by appropriate ligands, both receptors couple to Gαs proteins, stimulate adenylate cyclase activity, and increase intracellular cAMP concentration in a dose-dependent manner .

What are the optimal expression systems for recombinant xCRF-R1?

For recombinant expression of xCRF-R1, mammalian cell systems like HEK 293 cells have proven effective as demonstrated in comparative studies with human CRHR1 . These cells provide the necessary post-translational modifications, particularly glycosylation, which is critical as xCRF-R1 contains multiple N-linked glycosyl groups that affect protein localization and function. When designing expression constructs, attention should be paid to the signal peptide (21-24 amino acids) at the N-terminus, which is crucial for proper receptor trafficking to the cell membrane. For experimental purposes, including a fluorescent tag or epitope tag can facilitate localization studies and protein detection, but researchers should verify that such modifications don't interfere with receptor function through appropriate binding and signaling assays.

What purification strategies yield functional recombinant xCRF-R1?

Purification of functional xCRF-R1 requires careful consideration of its membrane protein nature. A multi-step approach typically yields best results: 1) Affinity chromatography using an appropriate tag (His-tag, FLAG-tag) for initial capture; 2) Size exclusion chromatography to separate monomeric receptor from aggregates; and 3) Ion exchange chromatography for final polishing. Throughout purification, maintaining the receptor in an environment with appropriate detergents (such as n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol) is crucial to preserve its native conformation. For functional studies, reconstitution into lipid nanodiscs or liposomes may be necessary. Quality control should include binding assays with radiolabeled ligands such as [125I]-h/rCRF to confirm that the purified receptor retains its characteristic ligand selectivity.

How can researchers optimize protein yield while maintaining functional integrity?

Optimizing recombinant xCRF-R1 expression requires balancing yield with functional integrity. Key strategies include: 1) Temperature modulation—lowering incubation temperature to 30°C after induction can increase the proportion of correctly folded receptor; 2) Addition of chemical chaperones such as dimethyl sulfoxide (0.5-2%) or glycerol (5-10%) to culture media; 3) Co-expression with molecular chaperones; 4) Use of inducible promoters with controlled expression rates to prevent formation of inclusion bodies; and 5) Supplementation with ligands during expression to stabilize the receptor. When harvesting cells, inclusion of protease inhibitors is essential to prevent degradation. Functional integrity should be verified through ligand binding assays and cAMP accumulation tests to ensure the receptor maintains its characteristic selectivity for h/rCRF over sauvagine or ovine CRF.

Which specific amino acids determine the ligand selectivity of xCRF-R1?

The ligand selectivity of xCRF-R1 is determined by specific amino acids in the N-terminal domain, particularly between positions 70 and 89. Five key amino acid positions have been identified through chimeric receptor and mutation studies: 76, 81, 83, 88, and 89 . In xCRF-R1, these positions contain Gln76, Gly81, Val83, His88, and Leu89, while the corresponding positions in human CRHR1 contain Arg76, Asn81, Gly83, Leu88, and Ala89. Mutation studies have shown that replacing these five amino acids in human CRHR1 with those from xCRF-R1 creates a receptor with approximately 30-fold higher affinity for human/rat CRF than for sauvagine . Conversely, changing these amino acids in xCRF-R1 to the human sequence completely eliminates the receptor's ligand selectivity. Among these residues, positions 76, 81, and 83 have the most significant impact on ligand selectivity, while positions 88 and 89 contribute to a lesser extent.

How do binding affinities compare between different CRF ligands for xCRF-R1?

The binding affinities of different CRF ligands for xCRF-R1 show significant variation, creating a clear selectivity profile:

LigandRelative Binding AffinityApproximate EC50
Human/rat CRFHighNanomolar range
Xenopus CRFHighNanomolar range
Urotensin IHighNanomolar range
UrocortinHighNanomolar range
Ovine CRFLow>30x higher than h/rCRF
SauvagineLow>30x higher than h/rCRF

This selectivity pattern contrasts sharply with human CRHR1, which binds all these ligands with similar high affinity . The dramatic difference in binding profiles, despite >80% sequence identity between the receptors, underscores the critical importance of the identified amino acid positions in the N-terminal domain for ligand recognition and binding. Binding studies have demonstrated that substitution of just three amino acids (positions 76, 81, and 83) in human CRHR1 results in an approximately 11-fold higher affinity for human/rat CRF compared to ovine CRF or sauvagine .

What methodologies are most effective for measuring ligand binding to xCRF-R1?

For accurate measurement of ligand binding to xCRF-R1, competitive binding assays using radiolabeled ligands remain the gold standard. Typically, [125I]-h/rCRF serves as the labeled ligand, with various unlabeled peptides as competitors. When conducting these assays, maintain consistent temperature (room temperature is standard for binding studies) and buffer conditions across experiments. For kinetic studies, time-course experiments tracking association and dissociation rates provide valuable insights into binding mechanisms. Alternative non-radioactive approaches include fluorescence-based assays using fluorescently-labeled ligands or bioluminescence resonance energy transfer (BRET) assays with appropriately tagged receptor and ligand pairs. Surface plasmon resonance (SPR) can be particularly valuable for determining binding kinetics when working with the purified N-terminal domain of the receptor. When interpreting results, remember that binding studies performed at room temperature may yield somewhat different results than functional assays typically conducted at 37°C .

How does the N-terminal domain structure influence ligand selectivity?

The N-terminal extracellular domain (ECD) of xCRF-R1 is the primary determinant of its ligand selectivity. Within this domain, amino acids 70-89 form a critical region for ligand binding . The short consensus repeat fold in the N-terminal domain is characteristic of Class B1 GPCRs and essential for peptide docking and agonist/antagonist binding. The specific arrangement of amino acids at positions 76 (Gln), 81 (Gly), 83 (Val), 88 (His), and 89 (Leu) creates a unique binding pocket that strongly favors h/rCRF, xCRF, urotensin I, and urocortin over oCRF and sauvagine. The N-terminal ECD likely interacts with the C-terminal portion of CRF ligands, while the transmembrane domains and extracellular loops interact with the N-terminal portion of the ligands in what's known as the "two-domain" binding model. This model explains how relatively small changes in the ECD sequence can dramatically alter ligand selectivity without affecting the receptor's ability to activate downstream signaling pathways once bound to an appropriate ligand.

What roles do post-translational modifications play in xCRF-R1 function?

Post-translational modifications significantly influence xCRF-R1 function. The receptor contains multiple N-linked glycosylation sites (specifically, seven N-linked glycosyl groups have been identified in similar receptors) that are crucial for proper protein folding, trafficking to the cell membrane, and potentially for ligand recognition. Phosphorylation represents another critical modification, with numerous phosphorylation sites (up to 37 in related CRHR1s) primarily involved in signal transduction, receptor desensitization, and internalization following ligand binding . These phosphorylation events regulate receptor sensitivity and play key roles in terminating the signal after prolonged stimulation. When designing expression constructs or interpreting experimental results, researchers should consider that alterations to these sites may affect receptor localization, ligand binding properties, and signaling capabilities. For recombinant expression, selecting systems that perform appropriate post-translational modifications is essential for obtaining functionally relevant receptor protein.

How do the transmembrane domains contribute to receptor activation?

While the N-terminal extracellular domain determines ligand selectivity, the seven transmembrane (TM) domains of xCRF-R1 are crucial for signal transduction following ligand binding. These TM domains exhibit high conservation between xCRF-R1 and mammalian CRHR1s, reflecting their essential role in receptor function . Upon ligand binding, conformational changes occur in the TM helices that facilitate coupling with G proteins, particularly Gαs. The intracellular loops connecting these TM domains serve as interaction sites for G proteins and other signaling molecules. The high degree of conservation in TM domains explains why xCRF-R1, despite its distinct ligand selectivity, activates similar downstream signaling pathways as mammalian CRHR1 when bound to appropriate ligands. This functional conservation amid selectivity differences makes xCRF-R1 a valuable model for studying the structural basis of GPCR activation mechanisms. Research indicates that mutations in the TM domains can affect receptor activation and G protein coupling without necessarily altering ligand binding properties, highlighting the distinct functional roles of different receptor domains.

What cell-based assays are most informative for studying xCRF-R1 function?

For comprehensive analysis of xCRF-R1 function, several complementary cell-based assays provide valuable insights. cAMP accumulation assays are essential as primary readouts since xCRF-R1 couples primarily to Gαs proteins. These can be performed using radioimmunoassays, enzyme immunoassays, or FRET-based sensors for real-time monitoring. Calcium mobilization assays using fluorescent calcium indicators (Fura-2, Fluo-4) are also informative as xCRF-R1 activation triggers calcium fluxes in a ligand dose-dependent manner . Receptor internalization assays utilizing fluorescently-tagged receptors provide insights into receptor trafficking and desensitization kinetics. Additionally, MAPK pathway activation can be monitored through phospho-ERK immunoblotting or reporter gene assays. For more detailed mechanistic studies, BRET or FRET approaches can detect conformational changes in the receptor upon ligand binding and interactions with downstream signaling partners. When designing these experiments, including appropriate positive controls (such as forskolin for cAMP assays) and negative controls is crucial for accurate interpretation of results.

How can researchers effectively design chimeric receptors to study domain functions?

Designing effective chimeric receptors for studying xCRF-R1 domain functions requires careful consideration of several factors. First, junction points should be placed in regions that maintain structural integrity, preferably at domain boundaries or in loop regions rather than within secondary structure elements. Second, conserved motifs essential for basic receptor function should remain intact. When creating chimeras between xCRF-R1 and human CRHR1, the high homology (>80%) facilitates successful chimera construction. PCR-based overlap extension methods are typically most effective for generating these constructs. To verify proper expression and localization, include epitope or fluorescent tags that don't interfere with function. Creating a comprehensive chimera library with systematic domain swaps provides the most informative results, as demonstrated in studies that identified the N-terminal domain as containing the complete ligand selectivity of xCRF-R1 . For each chimera, conduct thorough functional characterization including binding studies, signaling assays, and surface expression analysis to distinguish effects on ligand binding from effects on signal transduction.

What are the best approaches for site-directed mutagenesis studies of xCRF-R1?

Site-directed mutagenesis studies of xCRF-R1 require strategic planning to yield meaningful insights. Begin with comparative sequence analysis of xCRF-R1 and human CRHR1 to identify non-conserved residues, particularly in regions of interest such as the N-terminal domain. Prioritize residues based on their conservation across species, predicted structural importance, or location in functional domains. For the ligand-selective properties of xCRF-R1, focus initially on the region between amino acids 70-89 . Rather than single mutations, consider groups of mutations (as demonstrated by the finding that individual mutations often have minimal effect while combinations of mutations at positions 76, 81, and 83 dramatically alter selectivity) . PCR-based mutagenesis methods work well, but verify all constructs by sequencing. For functional analysis, compare binding affinities of different ligands using competitive binding assays, and assess signaling using cAMP accumulation or calcium mobilization assays. Structural modeling, if available, can provide context for interpreting mutation effects. When publishing results, present comprehensive data including binding constants, EC50 values, and maximum response levels for each mutant to facilitate comparative analysis.

How can xCRF-R1 research inform therapeutic developments for stress-related disorders?

Research on xCRF-R1 offers unique insights for therapeutic development despite its non-mammalian origin. The distinct ligand selectivity of xCRF-R1 provides a valuable natural model for studying how subtle structural changes affect ligand-receptor interactions in CRF systems. By comparing xCRF-R1 with human CRHR1, researchers can identify specific molecular determinants of ligand binding, particularly in the N-terminal domain region between amino acids 70-89 . This information can guide the rational design of selective CRHR1 antagonists that may have therapeutic potential for stress-related disorders, anxiety, and depression. The finding that just five amino acid changes can dramatically alter ligand selectivity suggests potential sites for therapeutic targeting. Additionally, understanding the structural basis for the differential binding of sauvagine and ovine CRF to xCRF-R1 versus human CRHR1 may inform the development of peptide-based therapeutics with tailored receptor selectivity profiles. This cross-species comparative approach has historically proven valuable in identifying critical functional domains that can be targeted for therapeutic intervention.

What evolutionary insights can be gained from comparative studies of xCRF-R1 and mammalian CRHR1?

Comparative studies of xCRF-R1 and mammalian CRHR1 provide valuable evolutionary insights into the CRF receptor family. Despite >80% sequence identity, these receptors display markedly different ligand selectivity profiles, highlighting how relatively few amino acid changes can dramatically alter receptor function during evolution . The high conservation of transmembrane domains alongside the diversification of extracellular domains suggests distinct evolutionary pressures on different receptor regions. This pattern aligns with the "two-domain" model of Class B GPCR function, where the N-terminal domain primarily determines ligand binding while conserved transmembrane regions mediate signaling. The differences in ligand preferences between amphibian and mammalian receptors likely reflect adaptation to different physiological needs and stress response systems. Examining the divergence points between these receptors can help identify functionally critical residues that have been maintained across hundreds of millions of years of evolution. This evolutionary perspective provides context for understanding both the core conserved functions of CRF receptors and the species-specific adaptations that have emerged in different vertebrate lineages.

How do conformational dynamics of xCRF-R1 differ with various ligands?

The conformational dynamics of xCRF-R1 likely vary significantly when bound to different ligands, contributing to its unusual selectivity profile. While xCRF-R1 binds human/rat CRF with high affinity, it displays much lower affinity for sauvagine and ovine CRF . These binding differences suggest distinct conformational states induced by different ligands. Advanced biophysical studies using hydrogen-deuterium exchange mass spectrometry (HDX-MS), single-molecule FRET, or NMR spectroscopy would be valuable for characterizing these conformational states. For high-affinity ligands like h/rCRF, the receptor likely adopts an optimal conformation that facilitates G-protein coupling and downstream signaling. In contrast, lower-affinity ligands like sauvagine may induce suboptimal conformational changes, resulting in reduced signaling efficiency. Interestingly, studies have noted that ovine CRF is a more potent stimulator of cAMP production than sauvagine in some contexts despite similar binding affinities , suggesting subtle differences in the conformational states induced by these ligands. Understanding these ligand-specific conformational dynamics could provide insights into biased signaling through CRF receptors and inform the development of functionally selective ligands for therapeutic applications.

What are the main challenges in expressing and purifying functional recombinant xCRF-R1?

Expressing and purifying functional recombinant xCRF-R1 presents several significant challenges. First, as a seven-transmembrane GPCR, xCRF-R1 has hydrophobic domains that can cause aggregation and misfolding during expression. Second, the receptor requires specific post-translational modifications, including N-linked glycosylation at multiple sites and appropriate phosphorylation, which may not be perfectly replicated in heterologous expression systems . Third, maintaining the receptor's native conformation during solubilization and purification requires careful selection of detergents that preserve structural integrity without disrupting function. To address these challenges, researchers should: 1) Use mammalian expression systems like HEK293 cells that provide appropriate post-translational machinery; 2) Consider fusion partners that enhance folding and stability; 3) Employ mild detergents like DDM or LMNG for solubilization; 4) Validate functional integrity through ligand binding assays specifically testing the characteristic selectivity for h/rCRF over sauvagine; and 5) Consider nanobody or single-chain antibody stabilization approaches that have proven successful for other GPCRs.

How can researchers troubleshoot signaling assays when working with recombinant xCRF-R1?

When troubleshooting signaling assays for recombinant xCRF-R1, researchers should systematically evaluate each component of the experimental system. If cAMP responses are weak or absent: 1) Verify receptor expression and membrane localization through immunoblotting and confocal microscopy; 2) Confirm receptor functionality using binding assays with radiolabeled ligands; 3) Test the general responsiveness of the cAMP detection system using forskolin as a direct adenylyl cyclase activator; 4) Ensure appropriate G-protein expression in the host cell system. For calcium mobilization assays, similar verification steps apply. If results differ from expectations based on binding data, consider that cAMP accumulation assays are typically performed at 37°C while binding assays are often conducted at room temperature, potentially affecting outcomes . Additionally, remember that small differences in binding affinities can result in larger differences in signaling potency due to receptor reserve effects. When comparing results across different ligands, always include full dose-response curves rather than single-point measurements and calculate both EC50 values and maximum responses to get a complete picture of signaling efficiency.

What considerations are important when designing experiments to compare xCRF-R1 with human CRHR1?

When designing comparative experiments between xCRF-R1 and human CRHR1, several key considerations ensure meaningful results. First, expression levels must be carefully controlled and quantified, as differences in receptor density can confound interpretation of pharmacological parameters. Surface expression can be verified using ELISA with antibodies against N-terminal epitope tags or through radioligand binding assays with saturating ligand concentrations. Second, experimental conditions should be identical for both receptors, including temperature, buffer composition, and assay duration. Third, use multiple ligands that span the selectivity spectrum (h/rCRF, oCRF, sauvagine, etc.) to fully characterize the pharmacological profiles. Fourth, employ multiple functional readouts (binding, cAMP, Ca2+, ERK phosphorylation) since receptors may show different patterns of signaling bias. Fifth, when designing chimeric receptors or mutations, create reciprocal constructs (human→Xenopus and Xenopus→human) to confirm that observed effects are truly due to the exchanged domains rather than non-specific structural disruption . Finally, consider the potential impact of different optimal temperatures, as Xenopus laevis normally lives at lower temperatures than mammals, which could affect receptor conformation and kinetics.

What are promising approaches for structural determination of xCRF-R1?

Determining the structure of xCRF-R1 presents both challenges and opportunities. Current promising approaches include: 1) Cryo-electron microscopy (cryo-EM), which has revolutionized GPCR structural biology and can capture the receptor in various conformational states with different ligands; 2) X-ray crystallography focusing on the N-terminal extracellular domain, which contains the ligand selectivity determinants between amino acids 70-89 , potentially co-crystallized with selective peptide ligands; 3) NMR spectroscopy for dynamic studies of receptor segments, particularly suited for the study of the flexible N-terminal domain; 4) Computational approaches including AlphaFold2 or RoseTTAFold, which have shown remarkable accuracy for protein structure prediction and could provide initial models for further refinement. For any structural approach, protein engineering strategies like thermostabilizing mutations, fusion partners (T4 lysozyme, BRIL), or conformational stabilization with nanobodies may be necessary. The unique ligand selectivity of xCRF-R1 makes it particularly valuable for structural studies comparing bound states with different ligands to elucidate the molecular basis of selective recognition.

How might single-cell techniques advance understanding of xCRF-R1 signaling dynamics?

Single-cell techniques offer transformative potential for understanding xCRF-R1 signaling dynamics beyond traditional population-based assays. Single-cell RNA sequencing could reveal how xCRF-R1 activation differentially regulates gene expression programs in responsive cells, potentially uncovering previously unrecognized signaling pathways or feedback mechanisms. Live-cell imaging with genetically encoded biosensors (for cAMP, Ca2+, or MAPK activity) would allow real-time visualization of signaling dynamics, revealing temporal patterns, oscillations, or compartmentalization of responses that are masked in population averages. Single-molecule imaging techniques could track individual receptor molecules to analyze their mobility, clustering, and internalization kinetics in response to different ligands. Additionally, combining patch-clamp electrophysiology with fluorescent sensors could correlate xCRF-R1 signaling with immediate electrical responses in neurons or other excitable cells. These approaches would be particularly valuable for comparing signaling dynamics induced by high-affinity ligands (h/rCRF) versus low-affinity ligands (sauvagine, oCRF) to determine whether qualitative differences in signaling exist beyond the quantitative differences in potency.

What potential applications exist for engineered xCRF-R1 variants with modified ligand selectivity?

Engineered xCRF-R1 variants with modified ligand selectivity offer several promising research and potential therapeutic applications. First, receptors with designed selectivity profiles could serve as biosensors for detecting specific CRF-related peptides in biological samples or screening assays. Second, engineered variants could be used to create animal models with altered stress responsiveness for studying anxiety, depression, or stress-related disorders. Third, the identification of key amino acids controlling ligand selectivity (positions 76, 81, 83, 88, and 89) provides a foundation for rational design of human CRHR1 variants with tailored pharmacological profiles for both research and potential therapeutic applications. Fourth, comparing signaling pathways activated by receptors with different engineered selectivity profiles could reveal biased signaling mechanisms that might be exploited therapeutically. Finally, the design principles learned from manipulating xCRF-R1 selectivity could be applied to other class B GPCRs to develop selective modulators. The systematic mutation approaches that identified the five key amino acids determining xCRF-R1 selectivity provide a methodological blueprint for similar engineering efforts with other receptors of therapeutic interest.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.