Recombinant Xenopus laevis Cytochrome b561 (cyb561)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your needs in the order remarks, and we will fulfill your request.
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your needs in the order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyb561; xcyt; Transmembrane ascorbate-dependent reductase CYB561; Cytochrome b-561; Cytochrome b561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
cyb561
Target Protein Sequence
MENALSSQNLGFMPYLVAGSQILGIANLAITGAWLAQLQRRFLWSGPLQFNVHPLCMVLG
MVFLCGEALLVYRVFRHETKRSTKILHGVLHIMALVISLVGVIAVFQYHQANGYPDMYSL
HSWCGIVTFTLYILQWIIGFSLFFIPGVAFTYRSQFKPLHEFFGRALFLSSIATSLLGLT
EKMFSEYSSHPAEGILVNSLGVLLVVFGAVIAYILTREDWRRPPLPEEQALSMDFKTLTE
GDSPTDQ
Uniprot No.
Target Background
Function
Cytochrome b561 (cyb561) is a transmembrane reductase that utilizes ascorbate as an electron donor in the cytoplasm. It transfers electrons across membranes to reduce monodehydro-L-ascorbate radical within the lumen of secretory vesicles. This function is critical for the regeneration and homeostasis of ascorbate within secretory vesicles, providing reducing equivalents necessary to support the activity of intravesicular enzymes.
Database Links
UniGene: Xl.6682
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Multi-pass membrane protein.
Tissue Specificity
Specific to neuroendocrine tissues.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
