Recombinant Xenopus laevis Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mt-co2 is synthesized via heterologous expression in diverse systems, with optimized protocols for high yield and purity:

ParameterDetailsSource
Expression HostsE. coli, yeast, baculovirus, or mammalian cells
Purification MethodsSDS-PAGE confirmation (≥85% purity) and affinity chromatography (His-tag)
Storage ConditionsLyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability

Optimization Challenges:

  • Host Selection: E. coli and yeast enable high-yield production, while mammalian systems improve post-translational modifications .

  • Tag Design: N-terminal His-tags enhance purification efficiency without disrupting functional domains .

Functional and Research Applications

Role in Mitochondrial Respiration:
mt-co2 is essential for Complex IV assembly and function:

  1. Electron Transfer: Mediates cytochrome c oxidation via its CuA center, transferring electrons to the catalytic subunit (mt-co1) .

  2. Oxygen Reduction: Collaborates with mt-co1 to reduce O₂ to H₂O, generating proton gradients for ATP synthesis .

Research Applications:

  • Disease Modeling: Xenopus models study mt-co2 mutations linked to mitochondrial Complex IV deficiency, Leigh’s disease, and cerebellar ataxia .

  • Protein Maturation: TMEM177 in Xenopus stabilizes mt-co2 during Complex IV biogenesis, highlighting its role in mitochondrial quality control .

Clinical and Experimental Relevance

Disease Associations:
Mutations in mt-co2 correlate with severe phenotypes:

ConditionSymptomsSource
Mitochondrial Complex IV DeficiencyHypertrophic cardiomyopathy, hepatomegaly, muscle weakness, cognitive impairment
Leigh’s DiseaseReversible aphasia, hemiparesis, lactic acidosis, optic atrophy
Cerebellar AtaxiaProgressive gait ataxia, cognitive decline, pigmentary retinopathy

Experimental Insights:

  • Gene Editing: CRISPR-based correction of mt-co2 mutations in Xenopus models aids therapeutic development .

  • Biomarker Potential: ELISA kits (e.g., EKL56434-96T) quantify mt-co2 levels in biological samples for diagnostic research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MAHPSQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITIMMTTKLTNTNLMDAQE IEMVWTIMPAISLIMIALPSLRILYLMDEVNDPHLTIKAIGHQWYWSYEYTNYEDLSFDS YMIPTNDLTPGQFRLLEVDNRMVVPMESPTRLLVTAEDVLHSWAVPSLGVKTDAIPGRLH QTSFIATRPGVFYGQCSEICGANHSFMPIVVEAVPLTDFENWSSSMLEA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. The BNC, composed of heme A3 and copper B (CuB), reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links

KEGG: xla:2642081

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of Cytochrome c oxidase subunit 2 in Xenopus laevis?

Cytochrome c oxidase subunit 2 (COX II) contains a dual core CuA active site and is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which plays a significant role in physiological processes . In the electron transport chain, the oxidized form of cytochrome c can accept an electron from the cytochrome c1 subunit of cytochrome reductase, and then transfer this electron to the cytochrome oxidase complex, representing the final protein carrier in mitochondrial electron transport . In Xenopus laevis, as in other organisms, this protein is crucial for cellular respiration and energy production, making it an important subject for comparative studies of mitochondrial function across species.

How does Xenopus laevis mt-co2 compare to other species' COX II proteins in terms of sequence conservation?

While the search results don't specifically address the sequence conservation of Xenopus laevis mt-co2, we can infer information from studies of other species. Multiple sequence alignment and phylogenetic analysis of COX II proteins typically show high sequence identity among related species, as demonstrated in studies of insect COX II . For Xenopus laevis mt-co2, researchers would expect significant conservation of functional domains, particularly the CuA active site, when compared to other vertebrates. This conservation reflects the fundamental importance of this protein in aerobic respiration across diverse taxa.

What are the predicted molecular characteristics of Xenopus laevis mt-co2?

Based on comparative analysis with COX II from other organisms, the Xenopus laevis mt-co2 would likely have molecular characteristics similar to those reported for other species. For reference, the COXII protein from Sitophilus zeamais has a molecular mass of 26.2 kDa with a pI value of 6.37 . The exact characteristics of Xenopus laevis mt-co2 would need to be determined experimentally through molecular cloning and characterization studies, similar to those performed for other proteins in Xenopus laevis.

What are the optimal conditions for cloning the full-length cDNA of Xenopus laevis mt-co2?

For cloning the full-length cDNA of Xenopus laevis mt-co2, researchers can adapt methodologies similar to those used for other Xenopus proteins. A recommended approach would be to:

  • Extract poly-A+ mRNA from Xenopus laevis tissues (oocytes are commonly used as a starting material)

  • Synthesize cDNA using reverse transcription with oligo-dT primers

  • Amplify the mt-co2 coding sequence using PCR with gene-specific primers designed based on the Xenopus laevis genome sequence

  • Clone the amplified product into an appropriate expression vector (e.g., pBR322 for initial cloning)

The exact primer design would be based on the specific mt-co2 sequence, focusing on conserved regions if the exact sequence is unknown. For verification, the cloned sequence should be analyzed to confirm the presence of the complete open reading frame (ORF) encoding the mt-co2 protein.

Which expression systems are most effective for producing recombinant Xenopus laevis mt-co2?

Based on successful approaches with similar proteins, several expression systems could be effective for recombinant Xenopus laevis mt-co2:

Expression SystemAdvantagesConsiderations
E. coli (e.g., Transetta DE3)High yield, cost-effective, well-established protocolsMay require optimization for proper folding of eukaryotic proteins
Insect expression vectors (e.g., pMIB/V5)Better post-translational modifications than bacterial systemsSuccessfully used for other Xenopus proteins
Xenopus oocytesNative cellular environment, useful for functional studiesLower protein yield, more complex methodology

For bacterial expression, the gene can be subcloned into an expression vector like pET-32a and induced by isopropyl β-d-thiogalactopyranoside (IPTG) in E. coli Transetta (DE3) expression system, as has been done successfully with other COX II proteins . The inclusion of a 6-His tag would facilitate purification using affinity chromatography.

How can I optimize the expression of soluble, functional recombinant Xenopus laevis mt-co2?

Optimizing the expression of soluble, functional recombinant Xenopus laevis mt-co2 requires addressing several key parameters:

  • Expression temperature: Lower temperatures (16-25°C) often improve protein folding and solubility

  • Induction conditions: Optimize IPTG concentration (typically 0.1-1.0 mM) and induction time

  • Co-expression with chaperones: Consider co-expressing with molecular chaperones to aid proper folding

  • Fusion tags: Besides His-tags for purification, solubility-enhancing tags like thioredoxin or SUMO can improve soluble expression

  • Buffer optimization: Include appropriate additives like glycerol or low concentrations of detergents in extraction buffers

Testing the enzymatic activity of the recombinant protein is essential to confirm functionality. For cytochrome c oxidase subunit II, this can be done by measuring its ability to catalyze the oxidation of substrate Cytochrome C (Cyt c) using spectrophotometric methods .

What is the most efficient purification strategy for recombinant Xenopus laevis mt-co2?

A multi-step purification strategy would be most effective for recombinant Xenopus laevis mt-co2:

  • Affinity chromatography: If expressed with a 6-His tag, Ni²⁺-NTA agarose affinity chromatography is highly effective as the primary purification step . This typically yields protein with 80-90% purity.

  • Secondary purification: Additional purification can be achieved through:

    • Ion exchange chromatography based on the predicted pI of the protein

    • Size exclusion chromatography to remove aggregates and further increase purity

  • Quality control: Confirm purity using SDS-PAGE and Western Blotting. Based on similar proteins, recombinant mt-co2 with a 6-His tag would be expected to have a molecular weight of approximately 26-30 kDa, though fusion constructs may appear larger (as seen with other COX II proteins that showed bands around 44 kD) .

The final concentration of purified fusion protein would ideally reach approximately 50 μg/mL or higher, similar to what has been achieved with other recombinant COX II proteins .

What analytical methods are most appropriate for characterizing the structural integrity and functional activity of purified recombinant Xenopus laevis mt-co2?

Several complementary analytical methods are recommended for comprehensive characterization:

MethodPurposeKey Parameters
UV-visible spectroscopyAssess heme incorporation and redox stateCharacteristic absorption peaks for properly folded cytochrome proteins
Circular dichroism (CD)Evaluate secondary structureα-helical content is critical for proper folding
Enzyme activity assayConfirm functional activityMeasure oxidation of cytochrome c substrate
Mass spectrometryVerify protein mass and detect post-translational modificationsAccurate mass determination
Infrared spectroscopyStructural analysisCan detect protein-substrate interactions

For functional assessment, UV-spectrophotometer analysis can be used to measure the protein's ability to catalyze the oxidation of substrate Cytochrome C, as demonstrated with other COX II proteins . Additionally, infrared spectrometer analysis can provide insights into structural features and potential interactions with substrates or inhibitors.

How can I assess the purity and yield of recombinant Xenopus laevis mt-co2 throughout the purification process?

To assess purity and yield throughout the purification process:

  • Protein concentration determination:

    • Bradford or BCA assay for total protein concentration

    • Absorbance at 280 nm (A280) using the predicted extinction coefficient

    • Compare concentrations at each purification step to calculate yield

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target >95% purity)

    • Western blotting using anti-His antibodies or specific antibodies against mt-co2

    • HPLC analysis for high-resolution purity assessment

  • Endotoxin testing:

    • For applications in biological systems, endotoxin levels should be <1 EU/μg

  • Documentation:

    • Maintain a purification table recording volume, concentration, total protein, and specific activity at each step

    • Calculate purification fold and recovery percentage to optimize the protocol

How can recombinant Xenopus laevis mt-co2 be used to study CO2 transport mechanisms across cell membranes?

Recombinant Xenopus laevis mt-co2 can be utilized in sophisticated experimental systems to study CO2 transport:

  • Xenopus oocyte expression system:

    • Xenopus oocytes provide an excellent model for studying membrane transport

    • Researchers can inject recombinant mt-co2 into oocytes or express it from injected cRNA

    • Simultaneous measurement of intracellular pH (pHi) and surface pH (pHS) can be used to monitor CO2 fluxes

  • Experimental design considerations:

    • Use pH-sensitive microelectrodes positioned at the cell surface to detect local pH changes resulting from CO2 movement

    • Vary extracellular buffer concentrations (e.g., HEPES at different concentrations) to study the effects on CO2 transport rates

    • Compare results with other proteins involved in CO2 transport, such as carbonic anhydrase IV, which has been shown to enhance CO2 fluxes across Xenopus oocyte plasma membranes

  • Data analysis:

    • Calculate maximum rate of pH change (dpHi/dt)max as a measure of CO2 influx

    • Determine time constants (τpHS) for pH changes to quantify transport kinetics

    • Compare transport rates under various experimental conditions to identify factors affecting mt-co2 function

What approaches can be used to study the interaction between recombinant Xenopus laevis mt-co2 and potential inhibitors or modulators?

Several sophisticated approaches can be employed to study interactions with inhibitors or modulators:

  • Molecular docking studies:

    • Create a structural model of Xenopus laevis mt-co2 based on homologous proteins

    • Use in silico molecular docking to predict binding sites and interaction energies

    • Similar approaches have identified that compounds like allyl isothiocyanate (AITC) can form hydrogen bonds with specific amino acid residues (e.g., a sulfur atom forming a 2.9 Å hydrogen bond with Leu-31 in other COX II proteins)

  • Spectroscopic methods:

    • Use UV-spectrophotometry to measure changes in enzyme activity in the presence of potential inhibitors

    • Apply infrared spectroscopy to detect structural changes upon inhibitor binding

  • Site-directed mutagenesis:

    • Introduce point mutations at predicted binding sites to confirm their importance

    • Compare the activity of wild-type and mutant proteins in the presence of inhibitors

    • This approach would build on insights from molecular docking studies

How can recombinant Xenopus laevis mt-co2 be used in comparative studies of mitochondrial function across species?

Recombinant Xenopus laevis mt-co2 offers valuable opportunities for comparative studies:

  • Evolutionary conservation analysis:

    • Compare enzymatic properties of recombinant mt-co2 from different species

    • Correlate functional differences with sequence variations

    • Investigate adaptation to different environmental conditions (e.g., temperature, oxygen availability)

  • Hybrid enzyme systems:

    • Create chimeric proteins with domains from different species

    • Test the functionality of these hybrid systems to identify critical regions

    • Explore how species-specific variations affect interaction with other components of the electron transport chain

  • Developmental biology perspectives:

    • Compare mt-co2 function between Xenopus tadpoles and adult frogs

    • Investigate how mitochondrial function changes during metamorphosis

    • Similar comparative approaches have been used to study immune responses in Xenopus, showing significant differences between tadpoles and adult frogs

What are common challenges in expressing recombinant Xenopus laevis mt-co2 and how can they be addressed?

ChallengePotential Solutions
Insoluble protein expression- Lower induction temperature (16-25°C)
- Reduce IPTG concentration
- Use solubility-enhancing fusion tags
- Test different E. coli strains (e.g., Transetta DE3)
Low protein yield- Optimize codon usage for expression host
- Test different growth media and conditions
- Scale up culture volume
- Consider alternative expression systems
Improper folding- Co-express with molecular chaperones
- Include appropriate cofactors in growth media
- Try periplasmic expression for disulfide bond formation
Lack of enzymatic activity- Ensure proper incorporation of metal cofactors
- Optimize purification to prevent denaturation
- Test different buffer conditions for activity assays
Proteolytic degradation- Add protease inhibitors during purification
- Use protease-deficient expression strains
- Reduce time between induction and harvesting

For each challenge, a systematic approach is recommended, changing one variable at a time and documenting the effects on protein expression and functionality.

How should experiments be designed to study the kinetic properties of recombinant Xenopus laevis mt-co2?

A comprehensive kinetic characterization requires careful experimental design:

  • Substrate concentration series:

    • Prepare a range of cytochrome c concentrations (typically 0.1-100 μM)

    • Measure initial reaction rates at each concentration

    • Plot data using Michaelis-Menten, Lineweaver-Burk, or Eadie-Hofstee methods to determine Km and Vmax

  • Temperature and pH optimization:

    • Test activity across a range of temperatures (10-40°C) relevant to Xenopus physiology

    • Evaluate activity across pH range 6.0-8.5 to determine pH optimum

    • Create 3D plots of activity as a function of both temperature and pH

  • Inhibition studies:

    • Test known cytochrome oxidase inhibitors (e.g., cyanide, azide)

    • Determine IC50 values and inhibition mechanisms (competitive, non-competitive, uncompetitive)

    • Compare inhibition profiles with those of other species' mt-co2

  • Data analysis considerations:

    • Use appropriate enzyme kinetics software for model fitting

    • Apply statistical tests to evaluate the significance of observed differences

    • Consider the effects of experimental conditions on enzyme stability

What controls should be included when studying the interaction of recombinant Xenopus laevis mt-co2 with other components of the electron transport chain?

Rigorous experimental design requires appropriate controls:

  • Positive and negative controls:

    • Positive control: Commercial cytochrome c oxidase with known activity

    • Negative control: Denatured enzyme or reaction mixture lacking key components

  • Specificity controls:

    • Test interaction with cytochrome c from multiple species

    • Use cytochrome c variants with modified residues at known interaction sites

    • Include other electron transport proteins that should not interact directly

  • System validation:

    • When using Xenopus oocytes as an expression system, include water-injected oocytes as controls

    • For inhibitor studies, include structurally similar compounds without inhibitory activity

    • When testing pH changes, position multiple electrodes at different locations to confirm consistency of measurements

  • Technical controls:

    • Run parallel reactions at multiple enzyme and substrate concentrations

    • Include time-course measurements to ensure linearity during initial rate determinations

    • Test for interference from buffer components or additives

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.