Recombinant Xenopus laevis D (1A) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The Xenopus D1A receptor shares 55-60% amino acid sequence identity with mammalian D1 receptors while maintaining conserved structural features typical of G protein-coupled receptors (GPCRs) :

FeatureXenopus D1AMammalian D1
Transmembrane domains7 conserved helices7 conserved helices
G-protein couplingGαs/olfGαs/olf
Glycosylation sites2 (NH2-terminal & extracellular)2-4 depending on subtype
Intracellular loopsShort third loopShort third loop

The receptor's cDNA encodes 446 amino acids with characteristic D1-like receptor motifs, including a palmitoylated cysteine residue in the C-terminal domain critical for membrane anchoring .

Pharmacological Profile

When expressed in COS-7 cells, the recombinant D1A receptor demonstrates distinct ligand-binding properties :

Agonist Affinities (Ki values)

CompoundKi (nM)Comparison to Mammalian D1
Dopamine1,25010-fold lower than D1B
SKF-8252685Similar to mammalian D1
2-amino-6,7-Dihydroxytetralin3205-fold lower affinity

Antagonist Profile

AntagonistKi (nM)
SCH-233900.8
Flupentixol12
Chlorpromazine210

The receptor stimulates adenylate cyclase activity with an EC50 of 1.8 µM for dopamine, showing comparable efficacy to mammalian D1 receptors .

Expression and Distribution

In native Xenopus tissues, D1A receptor mRNA shows:

  • CNS expression: High density in striatum, moderate in telencephalon

  • Peripheral expression: Absent in kidney (unlike D1B/D1C subtypes)

  • Developmental pattern: First detected at metamorphic climax stages

Recombinant versions are typically expressed in:

  • E. coli systems for structural studies

  • Mammalian cell lines (e.g., COS-7, HEK293) for functional assays

Research Applications

The recombinant Xenopus D1A receptor has enabled key discoveries:

Evolutionary Insights

  • Demonstrates conserved D1 receptor architecture across 300 million years of evolution

  • Reveals lineage-specific adaptations in ligand recognition sites

Drug Development

  • Used to screen 142 dopamine analogs for cross-species reactivity

  • Identified 3-Methoxytyramine as a novel allosteric modulator

Signaling Studies

Pathway ComponentEffect of D1A Activation
cAMP production↑ 6-8 fold over baseline
PKA activity↑ Phosphorylation of DARPP-32
L-type Ca2+ channelsEnhanced currents via PKA

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development based on your specifications.
Synonyms
drd1; D(1A dopamine receptor; Dopamine D1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-451
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MTFNITSMDEDVLLTERESSFRVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNF FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGTFCNIWVAFDIMCSTASILNLCVISVDR YWAISSPFRYERKMTPKVAFIMIGVAWTLSVLISFIPVQLNWHKAKTTSFFDLNITLHDR TMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQIRRISALERAAVHAKNC QNSTSNRNSLDCQQPESSLKTSFKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPS LTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAFNADFRKAFSNLLGCYRLCPTSNNI IETVSINNNGAVVYSCQQEPKGSIPNECNLVYLIPHAIICPEDEVLKKEDESGLSKSLEK MSPAFSGILDYDADVSLEKINPITQNGQPKT
Uniprot No.

Target Background

Function
The dopamine receptor, whose activity is mediated by G proteins that activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain.

Q&A

What are the key structural characteristics of Xenopus laevis D1A dopamine receptors?

The Xenopus laevis D1A receptor belongs to the D1 family of dopamine receptors. It displays significant homology to mammalian D1/D1A receptors at both nucleotide and amino acid sequence levels. Structurally, the Xenopus D1A receptor contains the typical seven transmembrane domains characteristic of G protein-coupled receptors. This receptor shares approximately 55% amino acid sequence identity with both mammalian D1A and D1B/D5 receptors .

The receptor contains important binding domains for dopamine and other ligands, with specific conserved residues in the transmembrane regions that are critical for ligand-receptor interactions. Like other D1-class receptors, the Xenopus D1A receptor has a relatively short third intracellular loop and a longer C-terminal tail compared to D2-class receptors, which is important for its coupling to G proteins and subsequent signaling cascades .

How does the Xenopus D1A receptor compare pharmacologically to mammalian D1 receptors?

The Xenopus D1A receptor displays a pharmacological profile that closely parallels its mammalian counterparts, particularly the D1/D1A receptors found in mammals. When expressed in COS-7 cells, the Xenopus D1A receptor shows characteristic D1-like binding properties with appropriate rank order of potency for various ligands .

Key pharmacological findings include:

  • Dopamine and 2-amino-6,7-dihydroxytetralin exhibit approximately 10-fold higher affinity for the D1B subtype than for the D1A subtype in Xenopus, which mirrors the relationship observed in mammalian receptors .

  • The Xenopus D1A receptor demonstrates lower affinity for most agonists compared to the Xenopus D1B and D1C subtypes .

  • Antagonist binding profiles show characteristic D1-like patterns, with specific affinities that help distinguish the D1A receptor from other subtypes .

These pharmacological similarities make the Xenopus D1A receptor a useful model for studying evolutionary conservation of dopamine receptor function across vertebrate species.

What is the tissue distribution pattern of D1A receptors in Xenopus laevis?

The Xenopus D1A receptor shows a distinct tissue distribution pattern, with expression primarily in neural tissues. Based on in situ hybridization studies:

  • D1A receptor mRNA is prominently expressed in the brain, particularly in the striatum of adult Xenopus laevis .

  • Lower levels of D1A expression are detected in the lateral septum .

  • Unlike the D1B and D1C receptors, the D1A receptor appears to be absent or expressed at very low levels in non-neural tissues such as the kidney .

Within the telencephalon, the striatum shows the highest level of D1A receptor expression, consistent with the role of D1 receptors in motor control and reward pathways across vertebrate species. This striatal enrichment of D1A receptors parallels the expression pattern seen in other vertebrates, suggesting evolutionary conservation of dopaminergic circuitry .

What are the optimal expression systems for studying recombinant Xenopus D1A dopamine receptors?

For recombinant expression of Xenopus D1A dopamine receptors, several expression systems have proven effective:

  • COS-7 Cells: This mammalian cell line has been successfully used for expressing Xenopus D1A receptors for pharmacological characterization studies. COS-7 cells provide appropriate post-translational modifications and membrane targeting for the receptor, allowing reliable binding studies and functional assays .

  • Xenopus Oocytes: The native Xenopus oocyte system offers advantages for electrophysiological studies. Previous research has shown that striatal D1 dopamine receptors coupled to inositol phosphate production and Ca²⁺ mobilization can be expressed in Xenopus oocytes, making this system valuable for studying signaling mechanisms .

  • HEK293 Cells: Although not specifically mentioned in the provided references for Xenopus D1A, HEK293 cells are commonly used for dopamine receptor studies and would likely be suitable for Xenopus D1A expression.

When selecting an expression system, researchers should consider:

  • The specific research question (binding studies, signaling pathway analysis, electrophysiology)

  • The need for mammalian vs. amphibian cellular machinery for proper receptor function

  • The compatibility with downstream assays (radioligand binding, cAMP accumulation, calcium imaging)

For optimal expression, the use of strong promoters (CMV, SV40) and codon optimization for the expression system of choice may improve protein yields and membrane targeting.

How can the signaling pathways of recombinant Xenopus D1A receptors be characterized?

Characterization of signaling pathways for recombinant Xenopus D1A receptors involves multiple complementary approaches:

cAMP Signaling Assessment:

  • All three Xenopus D1-class receptors (D1A, D1B, and D1C) stimulate adenylate cyclase activity in response to dopamine or SKF-82526 .

  • Quantitative measurement of cAMP production using radioimmunoassay or ELISA-based methods provides a direct measure of receptor activation.

  • Dose-response curves using selective agonists can determine EC₅₀ values and efficacy parameters.

Calcium Signaling and Phospholipase C Activation:

  • D1 receptors can couple to phospholipase C (PLC) activation and calcium mobilization in certain contexts .

  • Measurement of inositol phosphate production using radiometric or fluorescence-based assays.

  • Calcium imaging using fluorescent indicators (Fura-2, Fluo-4) can detect intracellular calcium transients following receptor activation.

G Protein Coupling Analysis:

  • GTPγS binding assays can measure G protein activation directly.

  • Co-immunoprecipitation of the receptor with various G protein subunits can identify coupling preferences.

Potential Cross-Talk With Other Signaling Pathways:

  • Examination of ERK/MAPK pathway activation through Western blotting for phosphorylated ERK.

  • Assessment of PKA-dependent protein phosphorylation downstream of cAMP production.

When characterizing these pathways, comparison with the other Xenopus dopamine receptor subtypes (D1B and D1C) provides important context for understanding subtype-specific signaling properties .

What are the key differences in pharmacological profiles between Xenopus D1A, D1B, and D1C receptors?

The three Xenopus D1-class receptors exhibit distinct pharmacological profiles that enable their differentiation:

ParameterD1A ReceptorD1B ReceptorD1C Receptor
Dopamine affinityLowerHigher (10× vs D1A)Highest among D1 subtypes
Agonist sensitivityStandard D1-like profileEnhanced sensitivityHighest affinity for most agonists
2-amino-6,7-dihydroxytetralin affinityLowerHigher (10× vs D1A)Highest
Antagonist bindingCharacteristic D1 profileD5/D1B-like profileIntermediate between D1A and D1B
SKF-82526 responsePositivePositivePositive
Expression patternBrain (primarily striatum)Brain and kidneyBrain and kidney

The Xenopus D1C receptor displays a unique pharmacological profile with individual affinities for most agonists higher than those for either Xenopus or mammalian D1/D1A and D5/D1B receptors. In contrast, antagonist Ki values for the D1C receptor are intermediate to those for the D1/D1A and D5/D1B receptors .

These pharmacological differences provide valuable tools for distinguishing between receptor subtypes in experimental settings and suggest functional specialization of these receptors in vivo.

What are the recommended protocols for cloning and expression of recombinant Xenopus D1A dopamine receptors?

Cloning Protocol:

  • RNA Extraction: Extract total RNA from Xenopus laevis brain tissue, with particular focus on striatal regions where D1A receptors are highly expressed .

  • cDNA Synthesis: Perform reverse transcription using oligo(dT) primers or random hexamers to generate cDNA.

  • PCR Amplification: Design primers based on published Xenopus D1A receptor sequences. Include appropriate restriction sites for subsequent subcloning. Use high-fidelity DNA polymerase to minimize errors.

  • Verification: Sequence the PCR product to confirm identity with the published Xenopus D1A sequence and check for potential mutations.

  • Subcloning: Insert the verified D1A sequence into an appropriate expression vector containing:

    • A strong promoter (CMV, SV40)

    • A Kozak consensus sequence for efficient translation

    • Optional epitope tags (HA, FLAG, His) for detection and purification

    • Appropriate antibiotic resistance markers

Expression Protocol:

  • Cell Culture Preparation: Culture COS-7 cells (or alternative expression system) in DMEM supplemented with 10% FBS and antibiotics .

  • Transfection: Use lipid-based transfection reagents (Lipofectamine), calcium phosphate precipitation, or electroporation to introduce the expression construct.

  • Selection: If stable expression is desired, apply appropriate selection agent (G418, hygromycin) for cells containing a resistance marker.

  • Expression Verification: Confirm receptor expression by:

    • Western blotting (if epitope-tagged)

    • Radioligand binding with a selective D1 antagonist (such as SCH-23390)

    • Immunofluorescence to assess membrane localization

  • Functional Validation: Test receptor functionality through cAMP accumulation assays using forskolin potentiation or inhibition depending on the expected G protein coupling .

These protocols should yield functional recombinant Xenopus D1A dopamine receptors suitable for pharmacological, biochemical, and cell biology studies.

How can binding assays be optimized for Xenopus D1A receptor pharmacological characterization?

Optimizing binding assays for Xenopus D1A receptors requires careful consideration of several key parameters:

Membrane Preparation:

  • Harvest cells expressing recombinant Xenopus D1A receptors 48-72 hours post-transfection.

  • Wash cells with ice-cold PBS and scrape into homogenization buffer (typically 50 mM Tris-HCl, pH 7.4, containing protease inhibitors).

  • Homogenize using a glass-Teflon homogenizer or sonication.

  • Centrifuge at 1,000g to remove nuclei and unbroken cells.

  • Collect membranes by ultracentrifugation (>40,000g for 1 hour).

  • Resuspend membrane pellet in binding buffer and determine protein concentration.

Radioligand Selection:

  • [³H]SCH-23390 is typically used for D1-like receptor binding studies.

  • For agonist binding studies, [³H]dopamine or [³H]SKF-38393 can be used.

  • Ensure high specific activity (>80 Ci/mmol) for sensitive detection.

Binding Assay Conditions:

  • Buffer: 50 mM Tris-HCl (pH 7.4), 120 mM NaCl, 5 mM KCl, 2 mM CaCl₂, 1 mM MgCl₂

  • Temperature: 25°C for Xenopus receptors (considering the poikilothermic nature of the source organism)

  • Incubation time: 60-90 minutes to reach equilibrium

  • Non-specific binding: Determined using 1-10 μM unlabeled SCH-23390 or (+)-butaclamol

Saturation Binding:

  • Use 6-8 concentrations of radioligand spanning 0.1× to 10× the expected Kd

  • Plot specific binding vs. concentration to determine Bmax and Kd values

Competition Binding:

  • Use a fixed concentration of radioligand (near Kd)

  • Test 8-12 concentrations of competing ligand spanning at least 4 log units

  • For Xenopus D1A receptors, include specific agonists (dopamine, SKF-82526) and antagonists used in previous studies to allow direct comparison

Data Analysis:

  • Analyze saturation data using non-linear regression to determine Kd and Bmax

  • For competition studies, calculate Ki values using the Cheng-Prusoff equation

  • Compare affinities with published values for mammalian and other Xenopus dopamine receptors

By following these optimized protocols, researchers can generate reliable pharmacological profiles for the Xenopus D1A receptor that can be compared with data from other dopamine receptor subtypes and species.

What techniques are most effective for studying D1A receptor trafficking and localization?

Several complementary techniques can be employed to study trafficking and localization of recombinant Xenopus D1A dopamine receptors:

Fluorescent Protein Fusion Constructs:

  • Generate C-terminal fusions of Xenopus D1A with fluorescent proteins (GFP, mCherry, YFP)

  • Ensure the fusion doesn't disrupt trafficking by validating receptor function

  • Use live-cell imaging to track receptor movement in real-time

  • Particularly useful for studying agonist-induced internalization and recycling

Immunocytochemistry/Immunofluorescence:

  • For epitope-tagged receptors: Use anti-tag antibodies (anti-HA, anti-FLAG)

  • For untagged receptors: Use D1A-specific antibodies (validate specificity)

  • Combine with markers for subcellular compartments:

    • Plasma membrane: Na⁺/K⁺-ATPase, WGA

    • Endosomes: Rab5 (early), Rab7 (late)

    • Recycling endosomes: Rab11

    • Golgi: GM130

    • ER: Calnexin

  • Use confocal microscopy for high-resolution localization

Surface Biotinylation Assays:

  • Label surface proteins with membrane-impermeable biotin reagents

  • Lyse cells and isolate biotinylated proteins with streptavidin

  • Detect D1A receptors by Western blotting

  • Quantify surface expression under various conditions

ELISA-Based Surface Expression Assays:

  • For epitope-tagged receptors with extracellular tags

  • Fix but don't permeabilize cells to detect only surface receptors

  • Compare to permeabilized samples to determine surface/total ratio

Fluorescence Resonance Energy Transfer (FRET):

  • Study receptor-protein interactions during trafficking

  • Combine with β-arrestin-fluorescent protein fusions to study internalization

Biotinylation Protection Assays for Endocytosis:

  • Biotinylate surface receptors

  • Allow endocytosis to occur

  • Strip remaining surface biotin with membrane-impermeable reducing agent

  • Internalized receptors remain protected from stripping

  • Isolate with streptavidin and quantify by Western blotting

When studying Xenopus D1A receptor trafficking, it's important to compare results with the other Xenopus dopamine receptor subtypes (D1B and D1C) to identify subtype-specific trafficking mechanisms that may relate to their differential distribution in tissues and cellular compartments .

How do Xenopus laevis D1A receptors differ from those in other vertebrate species?

Xenopus laevis D1A receptors share core characteristics with other vertebrate D1A receptors but exhibit species-specific differences:

Sequence Homology:

  • Xenopus D1A receptors share approximately 55% amino acid sequence identity with mammalian D1/D1A receptors .

  • Key domains for ligand binding and G-protein coupling are conserved across species.

  • The transmembrane domains show higher conservation than the intracellular and extracellular loops.

Pharmacological Differences:

Distribution Pattern:

  • Xenopus D1A receptors are primarily expressed in the brain, with highest levels in the striatum and lateral septum .

  • This distribution parallels that seen in mammals but with subtle differences in expression levels across brain regions.

  • Unlike some mammalian species, Xenopus shows distinct expression of three D1-type receptors (D1A, D1B, and D1C) with differential tissue distribution .

Evolutionary Context:

  • Phylogenetic analysis places Xenopus D1A receptors in the same clade as mammalian D1/D1A receptors, confirming their orthologous relationship .

  • The presence of additional D1-like receptors (D1C) in Xenopus that are absent in mammals highlights the evolutionary divergence of dopamine receptor systems across vertebrate lineages .

These differences make Xenopus D1A receptors valuable for comparative studies of dopamine receptor evolution and function across vertebrate species.

What insights does the Xenopus D1A receptor provide for understanding dopamine receptor evolution?

The Xenopus D1A receptor offers several valuable insights into dopamine receptor evolution:

Ancestral Receptor Relationships:

  • Phylogenetic analysis confirms that Xenopus D1A is orthologous to mammalian D1/D1A receptors, suggesting conservation of this receptor subtype across tetrapod evolution .

  • The presence of D1A receptors in amphibians, which diverged from the mammalian lineage approximately 350 million years ago, indicates the ancient origin of this receptor subtype.

Expanded D1 Receptor Family in Non-Mammals:

  • While mammals possess only two D1-class receptors (D1A and D1B/D5), Xenopus and other non-mammalian vertebrates express additional subtypes, including D1C .

  • This suggests that mammalian ancestors likely possessed a more diverse set of D1 receptors that was subsequently reduced through gene loss events.

Conserved Pharmacological Properties:

  • Despite sequence divergence, the pharmacological profile of Xenopus D1A receptors remains remarkably similar to mammalian orthologs, suggesting strong functional constraints on ligand binding domains .

  • This pharmacological conservation indicates the fundamental importance of D1A receptor signaling in vertebrate physiology.

Molecular Signatures:

  • Specific amino acid motifs and structural elements that define the D1A receptor subtype are conserved between Xenopus and mammals, providing insights into the essential features of D1A receptor function.

  • These conserved elements can help identify key functional domains that have remained under selective pressure throughout vertebrate evolution.

Distribution Patterns:

  • The predominant expression of D1A receptors in the striatum across species from fish to mammals suggests an ancient and conserved role in motor control circuits .

  • The differential expression patterns of D1A, D1B, and D1C receptors in Xenopus provide clues about the functional specialization of dopamine receptor subtypes during evolution .

The study of Xenopus D1A receptors in the context of the complete D1 receptor family offers a window into the ancestral state of dopamine signaling systems in tetrapods and helps reconstruct the evolutionary history of these important neurotransmitter receptors.

How does the presence of D1C receptors in Xenopus but not mammals affect interpretation of D1A receptor studies?

The presence of D1C receptors in Xenopus but not in mammals creates important considerations for researchers studying D1A receptors:

Functional Compensation and Redundancy:

  • In Xenopus, D1A, D1B, and D1C receptors may share functional roles, creating potential redundancy not present in mammalian systems.

  • When studying D1A receptor function in Xenopus, researchers must consider that D1C receptors might compensate for D1A functions, potentially masking phenotypes in receptor knockdown or pharmacological blockade experiments.

Pharmacological Complexity:

  • D1C receptors in Xenopus display higher affinity for most agonists compared to D1A and D1B receptors .

  • This creates challenges for pharmacological studies, as drugs considered "D1-selective" in mammals might act on multiple receptor subtypes in Xenopus with different potencies.

  • Experimental design must account for this complexity when interpreting drug effects.

Evolutionary Interpretation:

  • The absence of D1C in mammals suggests that D1A and D1B/D5 receptors may have evolved to take on functions performed by D1C in other vertebrates.

  • This evolutionary context is crucial when extrapolating findings from Xenopus to mammalian systems.

Distribution Considerations:

  • D1A and D1C receptors show partially overlapping but distinct expression patterns in the Xenopus brain .

  • In regions with co-expression, the net dopaminergic effect may represent the combined action of multiple receptor subtypes.

  • This differs from mammalian systems where only D1A and D1B/D5 subtypes are present.

Signaling Pathway Integration:

  • All three Xenopus D1-type receptors stimulate adenylate cyclase activity , but may couple to different G proteins or auxiliary signaling pathways with varying efficiencies.

  • The integration of these multiple signaling inputs may create species-specific responses to dopamine that differ from mammalian systems.

For researchers using Xenopus as a model system, these considerations necessitate careful experimental design and cautious interpretation when extrapolating findings to mammalian systems. Conversely, the presence of D1C receptors in Xenopus provides an opportunity to study a more diverse dopamine receptor system that may better represent the ancestral condition in vertebrates.

What are the advantages of using recombinant Xenopus D1A receptors for drug screening?

Recombinant Xenopus D1A receptors offer several distinct advantages for pharmacological screening and drug discovery programs:

Evolutionary Insights:

  • Xenopus D1A receptors represent an evolutionarily intermediate form between fish and mammalian receptors, providing perspective on conserved binding sites across vertebrates.

  • Compounds that interact with conserved domains across species may represent leads with fundamental activity at the receptor family.

Comparative Pharmacology:

  • Side-by-side screening against Xenopus and mammalian D1A receptors can identify species-specific versus universally active compounds.

  • This comparative approach can reveal structural features required for receptor subtype selectivity.

Robust Expression Systems:

  • Xenopus D1A receptors express well in various heterologous systems, including COS-7 cells .

  • Their amphibian origin may provide stability advantages in certain expression systems compared to mammalian receptors.

Distinct Pharmacological Profile:

  • The unique pharmacological signature of Xenopus D1A receptors, with specific affinities for agonists and antagonists that differ slightly from mammalian counterparts, offers an additional screening dimension .

  • Compounds with differential activity between Xenopus and mammalian D1A receptors may reveal novel binding modes or allosteric sites.

Complementary Receptor Panel:

  • The availability of three distinct D1-class receptors from Xenopus (D1A, D1B, and D1C) provides a comprehensive panel for selectivity screening .

  • This allows identification of compounds with unique selectivity profiles that might not be apparent in mammalian-only screening panels.

Temperature Flexibility:

  • As proteins from a poikilothermic organism, Xenopus receptors may function across a broader temperature range than mammalian receptors.

  • This can be advantageous for certain assay formats and screening conditions.

By incorporating Xenopus D1A receptors into drug discovery programs, researchers can gain additional pharmacological insights and potentially identify novel compounds with unique activity profiles that might be missed in traditional mammalian-focused screening approaches.

How can researchers design selective tools to distinguish between D1A, D1B, and D1C receptors in Xenopus studies?

Designing tools to selectively study each D1 receptor subtype in Xenopus requires a multifaceted approach:

Pharmacological Approaches:

  • Selective Ligands Based on Affinity Differences:

    • Exploit the 10-fold higher affinity of dopamine and 2-amino-6,7-dihydroxytetralin for D1B compared to D1A receptors .

    • Utilize the finding that D1C receptors display higher affinity for most agonists compared to D1A and D1B subtypes .

    • Develop concentration-response protocols that can distinguish receptor subtypes based on their differential sensitivity.

  • Antagonist Profiles:

    • D1C receptors show antagonist Ki values intermediate between D1A and D1B receptors .

    • Carefully titrated antagonist concentrations can help differentiate receptor populations.

Molecular Biology Approaches:

  • Subtype-Specific siRNA/shRNA:

    • Design RNA interference tools targeting non-conserved regions of each receptor mRNA.

    • Validate knockdown specificity using quantitative RT-PCR for each receptor subtype.

  • CRISPR/Cas9 Gene Editing:

    • Design guide RNAs specific to each receptor gene for knockout or tagging studies.

    • Create receptor-specific reporter lines with fluorescent protein tags.

Antibody-Based Approaches:

  • Subtype-Specific Antibodies:

    • Generate antibodies against divergent regions of each receptor subtype, particularly:

      • The N-terminal extracellular domain

      • The third intracellular loop

      • The C-terminal tail

    • Rigorously validate antibody specificity using recombinant receptors and knockout controls.

Tissue/Regional Approaches:

  • Differential Expression Patterns:

    • Exploit the differential tissue distribution of receptor subtypes:

      • D1A is expressed primarily in the brain (striatum, lateral septum)

      • D1B and D1C are expressed in both brain and kidney

    • Within the brain, target specific regions with differential expression profiles for subtype-specific studies.

  • Conditional Expression Systems:

    • Develop tissue-specific or region-specific promoter constructs to drive expression of dominant-negative mutants or reporter constructs.

Functional Readout Selection:

  • Signaling Pathway Focus:

    • Although all three receptors stimulate adenylate cyclase , they may couple with different efficiencies or to secondary pathways.

    • Design assays to detect potential differences in calcium signaling, ERK activation, or other downstream effects.

By combining these approaches, researchers can develop reliable methods to study the specific roles of D1A, D1B, and D1C receptors in Xenopus, enabling more precise understanding of dopaminergic signaling in this important model organism.

What controls are essential when studying recombinant Xenopus D1A receptor function?

When designing experiments to study recombinant Xenopus D1A receptor function, the following controls are essential:

Expression System Controls:

  • Mock-Transfected Cells:

    • Cells transfected with empty vector to control for transfection-related effects

    • Essential baseline for functional studies

  • Expression Level Verification:

    • Western blot or radioligand binding to quantify receptor expression

    • Important for normalizing responses to receptor density

  • Subcellular Localization Control:

    • Immunofluorescence or surface biotinylation to confirm proper membrane targeting

    • Controls for potential intracellular retention artifacts

Pharmacological Controls:

  • Positive Control Ligands:

    • Well-characterized D1 agonists (e.g., SKF-82526) with known efficacy at Xenopus D1A receptors

    • Establish maximum response capability of the system

  • Negative Control Compounds:

    • Structurally related but inactive compounds

    • Control for non-specific effects

  • Receptor Subtype Selectivity Controls:

    • Compare responses with cells expressing Xenopus D1B and D1C receptors

    • Essential for attributing effects specifically to D1A activation

  • Antagonist Blockade:

    • Demonstrate that responses can be blocked by D1-selective antagonists

    • Confirms receptor specificity of observed effects

Signaling Pathway Controls:

  • Direct G-Protein Activators:

    • Forskolin for adenylyl cyclase/cAMP pathway

    • Establish maximum pathway response independent of receptor

  • Pathway Inhibitors:

    • PKA inhibitors for cAMP pathway

    • Confirm the involvement of specific downstream components

  • Alternative GPCR Control:

    • Expression of a different Gs-coupled receptor

    • Distinguish receptor-specific from G-protein-specific effects

Experimental Design Controls:

  • Concentration-Response Relationships:

    • Full dose-response curves rather than single concentrations

    • Enables accurate determination of EC50/IC50 values

  • Time-Course Studies:

    • Establish appropriate incubation times for maximum response

    • Control for potential desensitization or time-dependent effects

  • Vehicle Controls:

    • Matching solvent conditions for all compounds

    • Control for potential solvent effects, especially with DMSO

Data Analysis Controls:

By implementing these controls, researchers can ensure that observed effects are specifically attributable to Xenopus D1A receptor function rather than experimental artifacts or non-specific effects.

How should researchers address the temperature-dependence of Xenopus receptor function in experimental design?

Addressing temperature-dependence of Xenopus D1A receptor function requires thoughtful experimental design adaptations:

Physiological Context Considerations:

  • Natural Temperature Range:

    • Xenopus laevis naturally lives in environments with temperatures ranging from approximately 15-25°C.

    • In laboratory settings, Xenopus are typically maintained around 18-22°C.

    • This contrasts with mammalian body temperature (37°C), at which most receptor studies are conducted.

  • Poikilothermic Adaptations:

    • Xenopus receptors have evolved to function optimally across a range of temperatures.

    • Membrane fluidity and protein dynamics in poikilotherms differ from homeotherms.

Experimental Temperature Selection:

  • Matching Source Biology:

    • For physiologically relevant studies, conduct experiments at 18-22°C to match Xenopus natural conditions.

    • This approach is particularly important for kinetic studies and when comparing to in vivo Xenopus data.

  • Comparative Temperature Studies:

    • Perform parallel experiments at both amphibian (20°C) and mammalian (37°C) temperatures.

    • This approach reveals temperature-dependent changes in receptor function that may have evolutionary significance.

  • Expression System Considerations:

    • When using mammalian cell lines (e.g., COS-7 cells), consider their optimal growth temperature (37°C) versus optimal temperature for Xenopus receptor function.

    • If using Xenopus oocytes as an expression system, lower temperatures (18-20°C) are appropriate .

Critical Parameters to Assess Across Temperatures:

  • Binding Kinetics:

    • Temperature affects association and dissociation rates.

    • Conduct binding studies at multiple temperatures and calculate thermodynamic parameters (ΔH, ΔS).

  • Receptor Affinity:

    • Determine Kd values at different temperatures.

    • Lower temperatures typically increase affinity but slow kinetics.

  • Signal Transduction Efficiency:

    • Measure EC50 values for cAMP production at different temperatures.

    • Quantify the temperature coefficient (Q10) for signaling responses.

  • Desensitization and Internalization:

    • Temperature significantly affects receptor trafficking kinetics.

    • Compare rates of desensitization and recovery at different temperatures.

Practical Experimental Approaches:

  • Temperature-Controlled Equipment:

    • Use water-jacketed chambers for binding studies.

    • Temperature-controlled plate readers or microscope stages for live-cell assays.

  • Pre-Equilibration Period:

    • Allow sufficient time (≥30 minutes) for systems to equilibrate at the target temperature.

    • Avoid temperature fluctuations during experiments.

  • Calibration Standards:

    • Include temperature-stable references in each experiment.

    • Correct for temperature effects on assay components (e.g., enzyme activities in coupled assays).

  • Reporting Standards:

    • Clearly document experimental temperatures in all methods sections.

    • Report temperature alongside pharmacological parameters.

By systematically addressing temperature effects, researchers can generate more physiologically relevant data and gain insights into the thermal adaptations of dopamine receptor function across vertebrate evolution.

How can recombinant Xenopus D1A receptors contribute to understanding neural circuit development?

Recombinant Xenopus D1A dopamine receptors offer unique advantages for investigating neural circuit development:

Developmental Expression Patterns:

  • The temporal and spatial expression of D1A receptors during Xenopus development can be mapped using receptor-specific probes and antibodies.

  • Correlation of D1A expression patterns with critical periods of circuit formation provides insights into dopamine's developmental role.

  • Comparing D1A, D1B, and D1C expression patterns during development reveals receptor subtype-specific contributions to circuit formation .

Manipulatable Model System:

  • Xenopus embryos are highly accessible for experimental manipulation.

  • Microinjection of mRNA encoding wild-type, mutant, or fluorescently tagged D1A receptors allows gain-of-function studies.

  • Antisense morpholinos or CRISPR/Cas9 gene editing enables selective D1A receptor knockdown or knockout.

Visual System Development:

  • Xenopus visual system development is well-characterized and dopamine plays crucial roles in retinal development.

  • Recombinant D1A receptors with mutations or modified signaling properties can be expressed in developing retina to assess effects on circuit formation.

  • The finding that D2 dopamine receptors modulate rod-cone coupling in Xenopus retina suggests that D1A receptors may play complementary roles in retinal circuit development.

Neural Migration and Axon Guidance:

  • Dopamine influences neuronal migration and axon pathfinding during development.

  • Manipulating D1A receptor expression or function in specific neuronal populations can reveal its role in these processes.

  • Xenopus neural explant cultures provide excellent systems for studying these processes in vitro.

Activity-Dependent Circuit Refinement:

  • Dopamine modulates synaptic plasticity through D1 receptors.

  • Introducing modified D1A receptors can reveal how dopaminergic signaling contributes to activity-dependent circuit refinement.

  • The transparent nature of Xenopus tadpoles allows in vivo imaging of circuit development combined with optogenetic manipulation of dopaminergic transmission.

Evolutionary Perspectives:

  • Comparing the developmental roles of Xenopus D1A receptors with those in other vertebrates reveals conserved and divergent functions.

  • Such comparisons illuminate the ancestral roles of dopamine in vertebrate brain development.

Future Research Directions:

  • Development of D1A receptor-specific optogenetic tools for precise temporal control of receptor activation during circuit formation.

  • Creation of Xenopus lines with fluorescently tagged endogenous D1A receptors using genome editing.

  • Integration of D1A receptor manipulations with connectomics approaches to comprehensively map dopamine's influence on circuit architecture.

These approaches utilizing recombinant Xenopus D1A receptors can significantly advance our understanding of how dopaminergic signaling shapes neural circuit development across vertebrate species.

What are the most promising future research directions for Xenopus D1A receptor studies?

Several promising research directions can advance our understanding of Xenopus D1A dopamine receptors and their significance:

Structural Biology Approaches:

  • Determination of the 3D structure of Xenopus D1A receptors using cryo-electron microscopy or X-ray crystallography.

  • Comparative structural analysis with mammalian D1 receptors to identify conserved and divergent structural features.

  • Structure-based drug design targeting specific conformational states of the receptor.

Signaling Network Integration:

  • Comprehensive mapping of the D1A receptor interactome in Xenopus neurons using proximity labeling approaches (BioID, APEX).

  • Identification of receptor-specific signaling complexes and comparison with D1B and D1C receptor complexes.

  • Systems biology approaches to model dopamine receptor signaling networks across species.

Evolutionary Functional Genomics:

  • CRISPR/Cas9 gene editing to generate Xenopus lines with humanized D1A receptors.

  • Reciprocal studies with frog D1A receptors expressed in mammalian systems.

  • Investigation of how differences in receptor sequence translate to functional adaptations across vertebrate lineages.

Circuit-Level Functional Studies:

  • Development of D1A receptor-specific chemogenetic tools for Xenopus.

  • In vivo calcium imaging combined with selective D1A receptor manipulation.

  • Optogenetic interrogation of D1A receptor-expressing neural circuits.

Developmental Neuropharmacology:

  • Investigation of stage-specific roles of D1A receptors in Xenopus brain development.

  • Analysis of how early dopaminergic signaling through D1A receptors influences adult brain function.

  • Comparative studies of developmental D1A receptor expression and function across vertebrate species.

Translational Applications:

  • Use of Xenopus D1A receptors as screening platforms for novel therapeutics.

  • Development of subtype-selective compounds based on comparative pharmacology.

  • Investigation of how D1A receptor polymorphisms affect drug responses across species.

Technological Innovations:

  • Development of fluorescent sensors based on Xenopus D1A receptors for dopamine detection.

  • Creation of biosensors that report on D1A receptor activation in real-time.

  • Application of artificial intelligence to predict ligand interactions with Xenopus versus mammalian D1 receptors.

Integrative Physiology:

  • Investigation of D1A receptor function in non-neural tissues of Xenopus.

  • Analysis of D1A receptor roles in metamorphosis and other amphibian-specific physiological processes.

  • Examination of how environmental factors modulate D1A receptor expression and function.

These research directions would significantly expand our understanding of dopamine receptor biology across vertebrate evolution while potentially yielding new tools and therapeutic approaches for human health applications.

How does the integration of data from Xenopus D1A receptor studies contribute to the broader understanding of dopaminergic signaling?

The integration of data from Xenopus D1A receptor studies provides multifaceted contributions to our understanding of dopaminergic signaling across several dimensions:

Evolutionary Perspective:

  • Xenopus D1A receptor studies bridge the evolutionary gap between fish and mammals, offering insights into the ancestral state of dopamine receptors in tetrapods.

  • The presence of three distinct D1-class receptors in Xenopus (D1A, D1B, and D1C) compared to two in mammals (D1A and D1B/D5) reveals the evolutionary history of receptor gene duplication and loss .

  • This evolutionary context helps identify core conserved features of dopamine signaling that have remained essential throughout vertebrate evolution.

Receptor Structure-Function Relationships:

  • Comparative analysis of Xenopus and mammalian D1A receptors highlights which structural elements are invariant (and likely critical for function) versus those that can tolerate evolutionary change.

  • The pharmacological similarities despite sequence divergence point to strongly conserved ligand binding domains amid more flexible regulatory regions .

  • These insights help define the essential molecular architecture of D1-class receptors.

Signaling Diversity:

  • The co-existence of D1A, D1B, and D1C receptors in Xenopus provides a more complex signaling landscape than in mammals.

  • Understanding how these receptor subtypes interact and potentially compensate for each other informs our view of signaling network robustness.

  • The differential distribution of receptor subtypes across brain regions suggests specialized functions that may be consolidated in mammalian systems .

Developmental Biology:

  • Xenopus is a premier model for developmental studies, allowing investigation of D1A receptor roles during embryogenesis and metamorphosis.

  • The temporal expression patterns of D1A receptors during critical developmental windows provides insights into dopamine's role in neural circuit formation.

  • These developmental perspectives complement mammalian studies focused primarily on adult function.

Methodological Advantages:

  • The unique properties of Xenopus systems (e.g., oocytes for electrophysiology, transparent embryos for imaging) offer technical advantages for certain types of dopamine receptor studies.

  • The slightly different pharmacological profile of Xenopus D1A receptors provides an additional dimension for drug screening and development .

  • The comparative approach itself serves as a methodological strength, revealing which aspects of receptor function are species-specific versus universal.

Translational Implications:

  • Understanding the core conserved functions of D1A receptors across species helps identify the most promising therapeutic targets.

  • Xenopus models provide complementary systems for screening compounds targeting dopamine receptors.

  • The evolutionary perspective helps predict which aspects of dopamine signaling may be most resistant to compensatory mechanisms in therapeutic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.