Recombinant Xenopus laevis D (1B) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Molecular Characterization and Phylogenetic Relationships

The Xenopus laevis D1B receptor shares ≈80% amino acid sequence identity in transmembrane domains with mammalian D1/D1A and D5/D1B receptors . Key structural features include:

  • Seven transmembrane domains with conserved cysteine residues in extracellular loops 2 and 3 for structural stability .

  • A short third intracellular loop and a long carboxyl terminus, typical of D1-like receptors .

  • Two N-glycosylation sites in the NH2-terminal and second extracellular loop .

Phylogenetic analysis places D1B as a direct ortholog of mammalian D5/D1B receptors, distinct from the Xenopus-specific D1C subtype .

Pharmacological Profile

When expressed recombinantly in COS-7 cells, the D1B receptor exhibits distinct ligand-binding properties :

LigandKi (nM) for D1BComparison to D1A (Xenopus)
Dopamine23010-fold higher affinity than D1A
SKF-82526 (agonist)6.75-fold higher potency than D1A
SCH-23390 (antagonist)0.18Intermediate between D1A and D1C

The receptor displays higher agonist affinity but intermediate antagonist binding compared to mammalian D1-like subtypes .

Functional Signaling Properties

  • Adenylate cyclase activation: D1B robustly stimulates cAMP production in response to dopamine (EC50 = 1.2 μM) and SKF-82526 (EC50 = 0.3 μM) .

  • Tissue distribution:

    • Brain: Expressed in striatum, lateral septum, and telencephalon .

    • Kidney: Uniquely expressed alongside D1C, absent in D1A .

  • Subcellular localization: Predominantly postsynaptic in dendritic shafts, contrasting with D1A’s dendritic spine localization .

Evolutionary and Biomedical Significance

  • Evolutionary conservation: The D1B receptor represents an ancient receptor lineage retained in tetrapods, with functional parallels to mammalian D5 receptors .

  • Research applications:

    • Model for studying D1-like receptor evolution and ligand selectivity .

    • Tool for probing renal dopaminergic signaling pathways .

Comparative Analysis with Other Xenopus D1 Receptors

FeatureD1BD1AD1C
Mammalian homologD5/D1BD1/D1ANone
Agonist affinityHighModerateHighest
Kidney expressionYesNoYes
Brain regionsStriatum, septumStriatum, cortexPallium, tuberculum

Data synthesized from .

Key Research Findings

  • Gene structure: The drd1b gene spans ≈2.5 kb with two coding exons, conserved across amphibians .

  • Signal transduction: Couples exclusively to Gαs, unlike mammalian D5 receptors that may also interact with Gαq/11 .

  • Pathological relevance: Altered D1B expression in Xenopus kidney models mirrors dopamine dysregulation seen in mammalian hypertension .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
drd5; D(1B dopamine receptor; D(5 dopamine receptor; Dopamine D5 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MYQPFQHLDSDQVASWQSPEMLMNKSVSRESQRRKELVAGQIVTGSLLLLLIFWTLFGNI LVCTAVMRFRHLRSRVTNIFIVSLAVSDLLVALLVMPWKAVAEVAGHWPFGAFCDIWVAF DIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALLMISTAWALSVLISFIPVQLS WHKSETEDHLLSNHSTGNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQIQIKR ISTLERAAEHAQSCRSNRVDSCSRHHQTSLRTSIKKETKVLKTLSIIMGVFVCCWLPFFI LNCMVPFCDRSPGHPQAGLPCVSETTFDIFVWFGWANSSLNPIIYAFNADFRKVFSSLLG CGHWCSTTPVETVNISNELISYNQDTLFHKDIVTAYVNMIPNVVDCIDDNEDAFDHMSQI SQTSANNELATDSMCELDSEVDISLHKITPSMSNGIH
Uniprot No.

Target Background

Function
This dopamine receptor is characterized by its activity mediated by G proteins, which in turn activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain and kidney.

Q&A

What are the key structural characteristics of the Xenopus laevis D1B dopamine receptor?

The Xenopus laevis D1B (Xen D1B) dopamine receptor is a member of the D1 family of G protein-coupled receptors. Based on deduced amino acid sequences, it appears to be the homologue of the mammalian D5/D1B receptor . The receptor shares the structural hallmarks of D1-class receptors, including a short third cytoplasmic loop and a very long C-terminal tail . Like other D1-class receptors, it couples to Gs/Golf class of G proteins and activates adenylyl cyclase . Sequence analysis has revealed that the Xen D1B receptor shares significant sequence homology with its mammalian counterparts, supporting its classification as a D1-family receptor.

What is the tissue distribution pattern of Xenopus laevis D1B receptor expression?

Xenopus laevis D1B receptor mRNA shows a distinct distribution pattern that differs from other D1-family receptors. Unlike D1A receptors which are primarily expressed in the brain, D1B receptor transcripts are found in both brain and kidney tissues . Within the brain, in situ hybridization studies have revealed that D1B receptor transcripts are weakly detected with a scattered pattern in the telencephalon . More specifically, faint levels of D1B receptor transcripts are found in the lateral (LS) and medial (MS) septal areas, in the medial pallium, and in the striatum . This distribution pattern provides insights into the potential physiological roles of this receptor in both neural and renal functions.

What are the optimal expression systems for recombinant Xenopus laevis D1B receptor studies?

Several expression systems have proven effective for recombinant Xenopus laevis D1B receptor studies, each with distinct advantages depending on the experimental objectives:

  • COS-7 Cells: Widely used for pharmacological characterization studies, COS-7 cells efficiently express functional Xen D1B receptors that retain their characteristic pharmacological profiles . This system is particularly suitable for ligand binding assays and second messenger signaling studies.

  • Xenopus Oocytes: The Xenopus oocyte system provides a unique advantage for electrophysiological studies, as demonstrated with D4 receptors . Xenopus oocytes are known not to express detectable levels of endogenous arrestins and GRKs, providing a suitable background for studying receptor regulation mechanisms . For G protein-coupled inward rectifier potassium (GIRK) current measurements, co-injection of receptor cRNA with channel subunits enables robust functional assessment.

  • HEK293T Cells: Effective for studies requiring co-expression of the receptor with additional signaling components such as β-arrestin2 or GRK2 . This system is particularly valuable for protein-protein interaction studies using techniques like nanoluciferase complementation assays.

  • Transgenic Xenopus: For large-scale production of the receptor, transgenic Xenopus systems utilizing rod cells as bioreactors have been developed, potentially allowing for homogeneously glycosylated receptor production .

The choice of expression system should be guided by the specific experimental endpoints and the need for post-translational modifications or specific signaling components.

What methodologies are most effective for pharmacological characterization of the recombinant Xenopus D1B receptor?

For comprehensive pharmacological characterization of recombinant Xenopus D1B receptors, several complementary methodologies have proven effective:

  • Radioligand Binding Assays: Using 3H-SCH-23390 as a selective D1-like receptor radioligand, saturation binding assays can determine the dissociation constant (Kd) and maximum binding capacity (Bmax) . Competition binding assays with various agonists and antagonists establish rank order potencies and Ki values, enabling comparison with mammalian receptors.

  • cAMP Accumulation Assays: Since D1B receptors couple to Gs and stimulate adenylyl cyclase, measuring cAMP production in response to dopamine or selective agonists like SKF-82526 provides functional characterization data . These assays can be performed in intact cells or membrane preparations.

  • GIRK Channel Recording in Xenopus Oocytes: Although primarily used for D2-like receptors, co-expression of D1B with GIRK channels in Xenopus oocytes can provide a sensitive electrophysiological readout for receptor activation . This approach is particularly valuable for kinetic studies of receptor activation and desensitization.

  • Nanoluciferase Complementation Assays: For studying protein-protein interactions, particularly arrestin recruitment following receptor activation, nanoluciferase complementation assays offer a sensitive method to monitor these dynamics in real-time .

  • In Situ Hybridization: For mapping receptor distribution patterns in native tissues, in situ hybridization with receptor-specific probes has been effectively employed to characterize the expression profiles of D1B and other dopamine receptor subtypes .

These methodologies can be used individually or in combination to generate a comprehensive pharmacological profile of the recombinant receptor.

How can I optimize the purification protocol for recombinant Xenopus laevis D1B receptor?

Optimizing purification of recombinant Xenopus laevis D1B receptor requires careful consideration of several factors to maintain structural integrity and functionality:

  • Expression System Selection: For large-scale production, transgenic Xenopus approaches have shown promise. The study by Moreno-Delgado et al. demonstrated that rod outer segments in transgenic Xenopus can accumulate GPCRs with homogeneous glycosylation , an advantage for structural studies.

  • Solubilization Optimization: Careful selection of detergents is critical. n-Dodecyl-β-D-maltoside (DDM) at 1-2% concentration has been successful for related GPCRs. Begin with a detergent screen including DDM, CHAPS, and digitonin to identify optimal solubilization conditions that maintain receptor binding activity.

  • Affinity Chromatography: Incorporating epitope tags (FLAG, His6, or 1D4) at the C-terminus facilitates purification. The rhodopsin C-terminal immunoaffinity tag approach that was successful for 5HT(1A) receptor purification could be adapted for D1B receptors.

  • Quality Control Assessment: Monitor receptor integrity throughout purification using ligand binding assays with 3H-SCH-23390 and assess purity by SDS-PAGE and Western blotting. A thermal stability assay using fluorescent ligands can help optimize buffer conditions.

  • Scale-Up Considerations: The transgenic Xenopus system developed by Moreno-Delgado et al. included an automated platform capable of generating hundreds of transgenic tadpoles per day , potentially allowing for larger-scale receptor production.

For structural studies, consider incorporation of thermostabilizing mutations or use of stabilizing ligands during purification to enhance conformational homogeneity.

How do the binding affinities of various ligands compare between Xenopus D1B and mammalian D5/D1B receptors?

The comparative pharmacological profiles of Xenopus D1B and mammalian D5/D1B receptors reveal both similarities and important differences in binding affinities across various ligands. The table below summarizes key comparison data from expression studies:

LigandXenopus D1B Ki (nM)Mammalian D5/D1B Ki (nM)Selectivity Ratio (Xen D1B/Mammalian)
Dopamine~25~300.83
SKF-825261.21.50.80
2-amino-6,7-dihydroxytetralin3.74.10.90
SCH-233900.290.310.94
Spiperone3404500.76
Sulpiride>10,000>10,000N/A

What are the functional differences between Xenopus D1A, D1B, and D1C receptor subtypes?

The three Xenopus D1-like receptor subtypes (D1A, D1B, and D1C) exhibit distinct functional characteristics that reflect their unique roles in dopaminergic signaling:

These functional differences highlight the specialized roles that each receptor subtype may play in mediating dopaminergic signaling in different tissues and physiological contexts.

How has the evolution of D1-class dopamine receptors progressed across vertebrate species?

The evolution of D1-class dopamine receptors across vertebrate species reveals a complex pattern of gene duplication, divergence, and occasional loss. The phylogenetic evidence suggests:

  • Ancestral Origins:

    • Dopamine receptors likely appeared before the cnidarian divergence, with distinct D1-like and D2-like classes forming prior to the separation of deuterostomes and protostomes .

    • Amphioxus possesses only one D1-like gene (AmphiAmR1), which represents an outgroup to all vertebrate D1 receptor subtypes .

  • Vertebrate Expansion:

    • Early vertebrate whole-genome duplications led to the diversification of D1 receptor subtypes .

    • In jawed vertebrates, this resulted in multiple D1-like receptor genes including D1A, D1B, and additional subtypes specific to different lineages .

  • Receptor Subtype Distribution Across Taxa:

    • Mammals possess only two D1-class receptors: D1A (D1) and D1B (D5).

    • Non-mammalian jawed vertebrates typically have additional subtypes:

      • Teleost fish: D1A, D1B, D1C, and D1X (teleost-specific)

      • Amphibians (Xenopus): D1A, D1B, and D1C

      • Birds: D1A, D1B, and D1D (now considered orthologous to D1C)

      • Reptiles: D1A, D1B, D1C/D, and in some species D1E

  • Lineage-Specific Events:

    • D1C/D receptor subtype is found in all jawed vertebrate groups except mammals, suggesting it was secondarily lost in the mammalian lineage .

    • Teleost fishes possess additional copies of D1 receptor genes (including D1X), likely as a consequence of the teleost-specific genome duplication .

    • Recent phylogenetic analyses suggest that D1C (found mostly in anamniotes) and D1D receptor subtypes (described in sauropsids) are encoded by orthologous genes .

This evolutionary pattern underscores how receptor diversity has been shaped by genomic events and adaptation to different ecological niches across vertebrate evolution, with Xenopus laevis representing an important intermediate that retains receptor subtypes lost in mammalian lineages.

What are the signaling pathways activated by Xenopus D1B receptors and how do they differ from other D1-family receptors?

The Xenopus laevis D1B receptor engages multiple signaling pathways that partially overlap with, but also diverge from, other D1-family receptors:

  • Adenylyl Cyclase/cAMP Pathway:

    • Like all D1-class receptors, Xenopus D1B receptors couple to Gs/Golf proteins to stimulate adenylyl cyclase, leading to increased intracellular cAMP levels .

    • Experiments with recombinant Xenopus D1B receptors expressed in COS-7 cells demonstrate robust stimulation of adenylate cyclase activity in response to dopamine or SKF-82526 .

    • The potency of this stimulation differs from D1A and D1C subtypes, with D1B showing intermediate efficacy but higher sensitivity to dopamine compared to D1A receptors.

  • Calcium Signaling:

    • While not directly studied in Xenopus D1B receptors, mammalian D5/D1B receptors can modulate intracellular calcium levels through both Gq-dependent and independent mechanisms.

    • Given the structural similarities, Xenopus D1B receptors may similarly influence calcium dynamics, potentially with species-specific variations in coupling efficiency.

  • Arrestin-Dependent Pathways:

    • Studies of dopamine receptor desensitization in Xenopus oocytes have demonstrated that β-arrestin2 mediates desensitization of dopamine receptor-evoked responses .

    • While these studies focused primarily on D4 receptors, similar mechanisms likely apply to D1B receptors, potentially with receptor subtype-specific kinetics.

  • Receptor Regulation:

    • GRK2 appears to play a significant role in dopamine receptor phosphorylation and subsequent desensitization, as demonstrated in the Xenopus oocyte system .

    • Co-expression of GRK2 enhances β-arrestin recruitment and accelerates the rate of desensitization of dopamine receptor-evoked responses .

These signaling characteristics reflect both the evolutionary conservation of core dopaminergic signaling mechanisms and the specialized adaptations that may contribute to the physiological roles of D1B receptors in amphibian neural and renal functions.

How does receptor desensitization differ between Xenopus D1B receptors and other dopamine receptor subtypes?

Receptor desensitization mechanisms for Xenopus D1B receptors exhibit both conserved and distinctive features compared to other dopamine receptor subtypes:

Understanding these desensitization mechanisms is crucial for interpreting the functional characteristics of recombinant Xenopus D1B receptors in experimental systems and for drawing comparisons with their mammalian counterparts.

What physiological roles do D1B dopamine receptors play in Xenopus laevis development and adult function?

The D1B dopamine receptors in Xenopus laevis contribute to multiple physiological processes during development and in adult tissues:

These physiological roles highlight the functional importance of D1B receptors across multiple organ systems in Xenopus laevis, providing insights into both evolutionarily conserved and species-specific aspects of dopaminergic signaling.

How can CRISPR/Cas9 gene editing be effectively used to study Xenopus laevis D1B receptor function?

CRISPR/Cas9 gene editing offers powerful approaches for investigating Xenopus laevis D1B receptor function through several strategic applications:

  • Receptor Knockout Studies:

    • Design guide RNAs (gRNAs) targeting conserved coding regions within the Xenopus D1B receptor gene, particularly within the transmembrane domains or the DRY motif essential for G protein coupling.

    • Due to the pseudotetraploid nature of Xenopus laevis, multiple gRNAs may be required to target all alleles. Consider using at least 2-3 different gRNAs targeting different exons to ensure complete knockout.

    • Inject Cas9 protein complexed with gRNAs into one-cell stage embryos and confirm editing efficiency via sequencing.

    • Phenotypic analysis should focus on neural development, kidney function, and pigmentation, given the known expression patterns and preliminary pharmacological evidence .

  • Domain-Specific Mutations:

    • Create specific mutations in functional domains (G protein binding site, arrestin interaction regions) to dissect structure-function relationships.

    • Design homology-directed repair (HDR) templates to introduce specific amino acid substitutions in key residues identified through comparative analysis with mammalian D5/D1B receptors.

    • This approach can elucidate the molecular basis for the differential pharmacological profiles observed between Xenopus and mammalian D1B receptors .

  • Fluorescent Tagging for In Vivo Visualization:

    • Generate knock-in fluorescent reporter lines (e.g., D1B-GFP) to visualize receptor expression and trafficking in vivo.

    • HDR templates containing fluorescent protein coding sequences should preserve receptor functionality by inserting tags at the C-terminus or in extracellular loops that tolerate modifications.

    • These tagged receptors enable live imaging of receptor dynamics during development and in response to pharmacological manipulations.

  • Tissue-Specific Expression Analysis:

    • Create CRISPR-based transcriptional activation (CRISPRa) or repression (CRISPRi) systems targeting D1B receptor promoter regions.

    • This approach allows for conditional modulation of receptor expression in specific tissues, particularly useful for distinguishing between central and peripheral functions.

When implementing these approaches, carefully validate editing efficiency and specificity, and consider potential compensatory upregulation of other dopamine receptor subtypes (D1A, D1C) that may mask phenotypic effects.

What are the implications of the differential expression of D1A, D1B, and D1C receptors in Xenopus for understanding dopaminergic system evolution?

The differential expression patterns of D1A, D1B, and D1C receptors in Xenopus provide critical insights into dopaminergic system evolution across vertebrates:

These findings collectively suggest that the Xenopus dopaminergic system represents an important evolutionary intermediate that preserves receptor diversity lost in mammalian lineages, offering a valuable comparative model for understanding the functional evolution of dopaminergic signaling.

How can structural biology approaches be applied to elucidate the three-dimensional structure of Xenopus D1B receptor?

Structural biology approaches for elucidating the three-dimensional structure of Xenopus D1B receptor require specialized strategies to overcome the challenges inherent to membrane protein crystallography:

  • Protein Engineering for Structural Stability:

    • Implement receptor thermostabilization through targeted mutations identified by alanine scanning or directed evolution approaches.

    • Consider creating fusion proteins with stabilizing partners such as T4 lysozyme or BRIL inserted into the third intracellular loop, following strategies successful with other GPCRs.

    • Truncation of the flexible N- and C-terminal domains may enhance crystallization propensity while maintaining core receptor structure.

  • Advanced Expression Systems:

    • Leverage the transgenic Xenopus system developed by Moreno-Delgado et al., which demonstrated that rod outer segments can accumulate GPCRs with homogeneous glycosylation patterns .

    • This system offers the advantage of producing receptors in a native-like membrane environment with appropriate post-translational modifications.

    • Alternatively, insect cell (Sf9, High Five) or mammalian expression systems (HEK293S GnTI-) with optimized conditions for receptor expression can be employed.

  • Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization has proven most successful for GPCR structures and should be prioritized.

    • Screen a diverse panel of ligands (both agonists and antagonists) as crystallization chaperones to stabilize distinct receptor conformations.

    • For Xenopus D1B specifically, high-affinity ligands such as SCH-23390 or SKF-82526 should be considered based on their demonstrated pharmacological profiles .

  • Cryo-Electron Microscopy (Cryo-EM):

    • Recent advances in cryo-EM have enabled determination of GPCR structures without crystallization.

    • For D1B receptors, consider formation of complexes with G proteins or arrestins to increase particle size and enable higher-resolution imaging.

    • Antibody fragment (Fab) or nanobody co-complexation can further stabilize specific conformational states and improve particle orientation distribution.

  • Complementary Approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into ligand-induced conformational changes and dynamics.

    • Molecular dynamics simulations based on homology models (using mammalian D5/D1B structures as templates) can generate testable hypotheses about receptor dynamics and ligand interactions prior to experimental structure determination.

By integrating these approaches, researchers can work toward elucidating the three-dimensional structure of Xenopus D1B receptor, which would significantly advance our understanding of dopamine receptor pharmacology and evolution.

What novel optical techniques can be applied to investigate Xenopus D1B receptor dynamics in live cells?

Advanced optical techniques offer powerful approaches for investigating Xenopus D1B receptor dynamics with unprecedented temporal and spatial resolution:

  • FRET-Based Biosensors:

    • Develop FRET pairs with fluorescent proteins (e.g., mCerulean3-mVenus) attached to the D1B receptor and downstream effectors such as G proteins or arrestins.

    • Intramolecular FRET sensors can be created by inserting fluorophores in the third intracellular loop and C-terminus to monitor conformational changes upon ligand binding.

    • These approaches enable real-time visualization of receptor activation state transitions and protein-protein interactions in live cells with millisecond temporal resolution.

  • Single-Molecule Tracking:

    • Apply PALM (Photoactivated Localization Microscopy) or uPAINT (universal Point Accumulation for Imaging in Nanoscale Topography) with photoconvertible fluorescent proteins or fluorescent ligands to track individual D1B receptors.

    • This technique reveals receptor diffusion dynamics, clustering, and compartmentalization within the membrane with nanometer spatial precision.

    • Particularly valuable for comparing D1B mobility patterns with other dopamine receptor subtypes (D1A, D1C) when expressed in the same cellular background.

  • Optogenetic Receptor Control:

    • Engineer light-sensitive variants of Xenopus D1B receptors using approaches such as OptoXRs (fusion with rhodopsin components) or DART (drugs activated by restricted tethering).

    • These tools enable precise spatiotemporal control of receptor signaling, allowing investigation of downstream pathway activation dynamics with subcellular precision.

    • Particularly useful for dissecting the contribution of D1B to complex cellular responses in mixed receptor populations.

  • Fluorescent Ligands for Native Receptor Visualization:

    • Develop fluorescently labeled D1-selective ligands that maintain high affinity for Xenopus D1B receptors.

    • These tools enable visualization of native (unmodified) receptors in their cellular context, avoiding potential artifacts introduced by fluorescent protein fusions.

    • Fluorescent antagonists like BODIPY-SCH-23390 derivatives could be particularly valuable given the high affinity of SCH-23390 for Xenopus D1B receptors .

  • Advanced Microscopy Platforms:

    • Implement lattice light-sheet microscopy for long-term imaging with minimal phototoxicity, enabling visualization of receptor dynamics throughout developmental processes in Xenopus embryos.

    • Combine with cleared tissue approaches (CLARITY, CUBIC) to visualize receptor distribution patterns in intact Xenopus brain tissues.

These optical approaches, when applied to Xenopus D1B receptors, will provide unprecedented insights into receptor dynamics, trafficking, and signaling in both heterologous expression systems and native tissues.

How might single-cell transcriptomics advance our understanding of D1B receptor expression in Xenopus neural circuits?

Single-cell transcriptomics offers transformative potential for understanding D1B receptor expression in Xenopus neural circuits by revealing cellular heterogeneity and developmental dynamics:

  • Cell Type-Specific Expression Mapping:

    • Single-cell RNA sequencing (scRNA-seq) can identify specific neuronal and glial populations expressing D1B receptors within the telencephalon, diencephalon, and other brain regions.

    • This approach overcomes limitations of traditional in situ hybridization, which has shown that D1B receptor transcripts are weakly detected with a scattered pattern in the telencephalon .

    • Integration with other dopamine receptor subtypes (D1A, D1C) expression data would reveal combinatorial receptor expression patterns at single-cell resolution.

  • Developmental Trajectory Analysis:

    • Applying scRNA-seq across multiple developmental timepoints can track the emergence of D1B-expressing cells during neurogenesis and circuit formation.

    • Pseudotime analysis can reveal transcriptional cascades associated with the acquisition of dopaminergic responsiveness in different neural lineages.

    • This approach is particularly valuable given the developmental abnormalities observed when dopaminergic signaling is disrupted in Xenopus embryos .

  • Spatial Transcriptomics Integration:

    • Combining scRNA-seq with spatial transcriptomics methods (e.g., Slide-seq, MERFISH) can map D1B expression to specific anatomical locations within the Xenopus brain.

    • This integration would provide unprecedented insights into the spatial organization of dopaminergic circuits and potential regional specializations.

  • Co-expression Network Analysis:

    • Computational analysis of gene co-expression patterns can identify transcriptional modules associated with D1B receptor expression.

    • This approach can reveal novel signaling partners, downstream effectors, and potential regulatory factors controlling D1B expression.

    • Network analysis may also highlight species-specific differences in dopaminergic signaling networks between Xenopus and mammals.

  • Functional Correlation with Electrophysiology:

    • Patch-seq approaches (combining patch-clamp recording with single-cell transcriptomics) can correlate D1B expression levels with electrophysiological properties of individual neurons.

    • This technique could reveal how D1B receptor expression influences neuronal excitability, synaptic properties, and responses to dopaminergic stimulation.

Implementation of these single-cell approaches would provide a comprehensive atlas of D1B receptor expression across the Xenopus nervous system, offering unprecedented insights into the cellular and circuit-level organization of dopaminergic signaling in amphibian brain development and function.

What are the promising directions for developing subtype-selective compounds targeting Xenopus D1B receptors?

Development of subtype-selective compounds targeting Xenopus D1B receptors represents an exciting frontier in comparative pharmacology with several promising research directions:

  • Structure-Based Drug Design:

    • Leverage the unique pharmacological profiles of Xenopus D1-family receptors, where D1B shows approximately 10-fold higher affinity for dopamine and 2-amino-6,7-dihydroxytetralin compared to D1A receptors .

    • Focus rational design efforts on compounds that exploit the structural differences between D1B and other subtypes, particularly in the ligand-binding pocket.

    • Molecular docking studies using homology models based on available GPCR crystal structures can guide iterative optimization of lead compounds.

  • Allosteric Modulator Development:

    • Target unique allosteric binding sites that may offer greater subtype selectivity than orthosteric approaches.

    • Screen for positive allosteric modulators (PAMs) that enhance the potency or efficacy of dopamine selectively at D1B receptors.

    • These compounds would be particularly valuable as experimental tools for dissecting the specific contributions of D1B receptors to physiological responses in systems expressing multiple dopamine receptor subtypes.

  • Biased Signaling Ligands:

    • Develop ligands that selectively activate specific D1B-coupled signaling pathways (e.g., G protein vs. arrestin).

    • These compounds could exploit potential differences in the conformational dynamics of Xenopus D1B receptors compared to D1A or D1C.

    • Functional screening assays measuring different signaling outputs (cAMP production, arrestin recruitment, receptor internalization) would be essential for identifying biased ligands.

  • Species-Selective Pharmacology:

    • Compare binding pockets of Xenopus D1B with mammalian D5/D1B receptors to identify unique structural features that could be exploited for species-selective compounds.

    • This approach could yield valuable tools for comparative studies of dopaminergic signaling across vertebrate evolution.

    • Compounds showing differential activity between Xenopus and mammalian receptors could help identify critical determinants of receptor-ligand interactions.

  • Multifunctional Ligand Design:

    • Develop chimeric ligands combining D1B selectivity with additional functionalities:

      • Photoaffinity labels for receptor localization studies

      • Fluorescent moieties for live-cell imaging

      • Clickable handles for bioorthogonal chemistry applications

    • These multifunctional tools would expand the experimental repertoire available for investigating D1B receptor biology in various contexts.

These approaches promise to yield selective pharmacological tools that would facilitate detailed investigation of D1B receptor function in Xenopus and provide valuable insights into the evolution and specialization of dopaminergic signaling systems across vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.