Recombinant Xenopus laevis D (1C) dopamine receptor

Shipped with Ice Packs
In Stock

Description

Introduction to Xenopus laevis D(1C) Dopamine Receptor

The D(1C) dopamine receptor is one of three distinct D1-like dopamine receptors identified in Xenopus laevis. Alongside the D1A and D1B subtypes, it belongs to the D1 class of dopamine receptors which are characterized by their ability to stimulate adenylate cyclase activity. While mammals possess only two D1-like receptor subtypes (D1/D1A and D5/D1B), non-mammalian vertebrates like amphibians and fish have additional D1-like receptor subtypes, suggesting a more complex dopaminergic system in these species .

The D(1C) receptor was initially characterized in Xenopus laevis and subsequently identified in several teleost fishes including eel, carp, and tilapia . It displays unique pharmacological properties, including resistance to desensitization, which makes it functionally distinct from D1A and D1B receptors . The recombinant form of this receptor has become an essential tool for studying its properties and functions in controlled laboratory settings, allowing researchers to investigate its role in dopaminergic signaling pathways and evolutionary significance.

Genetic Characterization

Molecular phylogenetic analyses have shown that D(1C) receptor sequences from Xenopus form a distinct clade separate from other D1-like receptors. Interestingly, the D(1C) receptor shares a molecular signature with D(1D) receptors in the first extracellular loop between the second and third transmembrane domains, suggesting a close evolutionary relationship between these receptor subtypes . This finding provides evidence for the complex evolutionary history of dopamine receptors in vertebrates and highlights the value of studying non-mammalian species to understand receptor diversification.

Binding Characteristics

One of the most notable characteristics of the D(1C) receptor is its high affinity for agonists. Studies have shown that the receptor has individual affinities for most agonists that are higher than those for either Xenopus or mammalian D1/D1A and D5/D1B receptors . This suggests that the D(1C) receptor might be more sensitive to dopamine and related compounds, potentially allowing for activation at lower concentrations of these ligands.

In contrast to its high agonist affinity, the D(1C) receptor shows antagonist Ki values that are intermediate to those for the D1/D1A and D5/D1B receptors . This mixed pharmacological profile underscores the unique nature of the D(1C) receptor and highlights its potential value as a model for understanding the structural determinants of ligand binding in dopamine receptors.

Signal Transduction

Like other members of the D1 family, the Xenopus laevis D(1C) dopamine receptor is coupled to the stimulation of adenylate cyclase activity. Experimental evidence has demonstrated that the D(1C) receptor stimulates adenylate cyclase in response to dopamine or the synthetic agonist SKF-82526 . This signaling mechanism leads to increased production of cyclic AMP (cAMP), which acts as a second messenger to trigger various intracellular responses.

A distinctive feature of the D(1C) receptor is its reported resistance to desensitization, which distinguishes it from D1A or D1B receptors . Desensitization refers to the process by which a receptor becomes less responsive to continued stimulation, a mechanism that can regulate signal intensity and duration. The resistance to desensitization observed in the D(1C) receptor suggests that it might mediate more sustained responses to dopamine compared to other D1-like receptors, potentially contributing to unique physiological roles in Xenopus laevis.

Tissue Distribution

The Xenopus laevis D(1C) dopamine receptor exhibits a specific pattern of expression across different tissues. Studies have detected mRNA for the D(1C) receptor in both brain and kidney tissues . This distribution pattern differs from that of the D1A receptor, which is primarily expressed in the brain, and parallels that of the D1B receptor, which is also found in both brain and kidney.

The following table summarizes the tissue distribution of D1-like receptors in Xenopus laevis:

Receptor SubtypeBrainKidneyOther Tissues
D1AHighNot detected-
D1BHighDetected-
D1CHighDetected-

The expression of the D(1C) receptor in the kidney suggests that it might play a role in renal function, possibly in the regulation of dopamine-mediated effects on kidney physiology, such as sodium transport or blood flow regulation.

Brain Expression Pattern

Within the brain of adult Xenopus laevis, the D(1C) receptor shows a specific expression pattern. It is found in the medial and lateral pallium, as well as in the striatum and septum . This distribution pattern suggests involvement in multiple neural circuits and functions, potentially including cognitive, motor, and limbic processes.

In comparison, the D1A receptor is primarily expressed in the striatum and, to a lesser extent, in the lateral septum, while the D1B receptor shows weak, scattered expression throughout the telencephalon . The distinct expression pattern of the D(1C) receptor suggests specialized roles in specific neural circuits that may differ from those of other D1-like receptors.

Interestingly, while D(1C) expression is relatively modest in the telencephalon, it is notably present in regions homologous to structures that, in mammals, are involved in reward processing, motor control, and emotional regulation. This suggests a potential role for the D(1C) receptor in these fundamental neurological functions within the amphibian brain.

Production Methods

Recombinant Xenopus laevis D(1C) dopamine receptor has been produced using various expression systems for research purposes. According to available information, the full-length protein (amino acids 1-465) has been expressed in Escherichia coli with an N-terminal His tag . This expression system allows for the production of sufficient quantities of the receptor for various applications, including structural studies, pharmacological assays, and antibody production.

The recombinant protein production typically involves the following key steps:

  1. Cloning of the drd1c gene into an appropriate expression vector

  2. Transformation of the expression construct into E. coli

  3. Induction of protein expression under optimized conditions

  4. Purification of the recombinant protein, often using affinity chromatography based on the His tag

  5. Quality control assessment, including purity determination by SDS-PAGE

Alternative expression systems, such as mammalian cells, have also been used for the production of the recombinant D(1C) receptor . The choice of expression system can significantly affect the protein's post-translational modifications, folding, and functional properties, making it an important consideration in recombinant protein production.

Physical and Chemical Properties

The recombinant Xenopus laevis D(1C) dopamine receptor is typically available in lyophilized powder form or in solution with specific buffer compositions . When produced as a lyophilized powder, the protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For optimal stability, it is recommended to add glycerol (typically to a final concentration of 50%) and aliquot the protein for long-term storage .

Commercial preparations of the recombinant D(1C) receptor typically have the following characteristics:

PropertyDescription
FormLyophilized powder
Purity>85-90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionIn deionized sterile water (0.1-1.0 mg/mL)
TagN-terminal His tag or as determined during production

The high level of purity (>85-90%) achieved in commercial preparations is essential for many research applications, particularly those requiring precise quantification or those sensitive to contaminants.

Pharmacological Assays

The recombinant D(1C) receptor has been employed in pharmacological assays to characterize its binding properties and response to various ligands. These assays typically involve expressing the receptor in cell lines, such as COS-7 cells, and measuring its interaction with different compounds . Such studies have revealed the unique pharmacological profile of the D(1C) receptor, including its high affinity for dopamine and other agonists.

Pharmacological studies with the D(1C) receptor have demonstrated that it has a distinct rank order of potency for various ligands compared to other D1-like receptors . This information is valuable for understanding the structural basis of ligand recognition and specificity in dopamine receptors. By comparing the binding properties of different receptor subtypes, researchers can identify key residues and structural features that determine specificity and affinity.

The D(1C) receptor's resistance to desensitization also makes it an interesting subject for studies of receptor regulation and signaling dynamics . Understanding the molecular basis of this property could provide insights into mechanisms of receptor desensitization and potential strategies for modulating these processes in therapeutic contexts.

Evolutionary Studies

The Xenopus laevis D(1C) dopamine receptor has played a significant role in evolutionary studies of the dopaminergic system. Comparative analyses of D1-like receptors across different vertebrate species have provided insights into the diversification and specialization of these receptors during evolution . The D(1C) receptor, being absent in mammals but present in amphibians and fish, represents an interesting case study in the evolution of neurotransmitter systems.

Molecular phylogenetic analyses involving the D(1C) receptor have helped to establish the evolutionary relationships between different dopamine receptor subtypes and to reconstruct the history of gene duplications and losses in this receptor family . These studies have revealed that the D(1C) receptor shares a molecular signature with D(1D) receptors in the first extracellular loop between the second and third transmembrane domains, suggesting a close evolutionary relationship between these subtypes .

The presence of the D(1C) receptor in amphibians and fish, but its absence in mammals, raises interesting questions about the evolution of dopaminergic signaling systems. It suggests that mammals may have lost this receptor subtype during evolution, possibly due to functional redundancy or changes in the selection pressures acting on dopamine signaling. Alternatively, the functions of the D(1C) receptor might have been assumed by other receptor subtypes in mammals.

Comparison with Xenopus D1A and D1B Receptors

The Xenopus laevis D(1C) dopamine receptor shows distinct differences from the other D1-like receptors found in the same species. While the D1A and D1B receptors appear to be homologues of mammalian D1/D1A and D5/D1B receptors, respectively, the D(1C) receptor represents a unique subtype with no clear mammalian counterpart .

The following table compares key characteristics of the three D1-like receptor subtypes in Xenopus laevis:

CharacteristicD1AD1BD1C
Mammalian HomologueD1/D1AD5/D1BNone
Agonist AffinityLowerHigher than D1AHighest
Antagonist AffinitySpecific profileSpecific profileIntermediate between D1A and D1B
Adenylate Cyclase StimulationYesYesYes
Brain ExpressionPrimarily striatumWeak, scatteredMedial/lateral pallium, striatum, septum
Kidney ExpressionNoYesYes
DesensitizationNormalNormalResistant

In terms of pharmacology, the D(1C) receptor exhibits higher affinities for most agonists compared to both D1A and D1B receptors from Xenopus . This distinct pharmacological profile suggests that the D(1C) receptor might mediate dopamine responses at lower concentrations of the neurotransmitter, potentially allowing for finer regulation of dopaminergic signaling.

Comparison with Mammalian Dopamine Receptors

The Xenopus laevis D(1C) dopamine receptor lacks a direct homologue in mammals, which possess only two D1-like receptor subtypes: D1/D1A and D5/D1B. The D(1C) receptor displays approximately 55% amino acid sequence identity with both mammalian D1A and D1B/D5 receptors, indicating significant divergence from these subtypes .

The absence of a D(1C) receptor in mammals raises interesting questions about the evolution of the dopaminergic system. It suggests that mammals might have lost this receptor subtype during evolution, potentially compensating for its absence through changes in the properties or expression patterns of the remaining D1-like receptors. Alternatively, mammals might have developed alternative mechanisms or pathways to fulfill the functions mediated by the D(1C) receptor in non-mammalian vertebrates.

The study of the D(1C) receptor thus provides a valuable perspective on the evolution of neurotransmitter systems, highlighting the diversity of signaling mechanisms that have evolved across different vertebrate lineages. This comparative approach can reveal aspects of dopamine signaling that might not be apparent from studies focused solely on mammalian systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. Should you require dry ice, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we advise briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us and we will prioritize its development.
Synonyms
drd1c; D(1C dopamine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
drd1c
Target Protein Sequence
MENFSIFNVTVNVWHADLDVGNSDLSLRALTGLLLSLLILSTLLGNTLVCLAVIKFRHLR SKVTNFFVISLAVSDLFVALLVMPWKAVTEVAGFWVFGDFCDTWVAFDIMCSTASILNLC IISLDRYWAIASPFRYERKMTQRVAFIMIGVAWTLSILISFIPVQLSWHKSHEADEELNG VNHTENCDSSLNRTYAISSSLISFYIPVVIMIGTYTRIYRIAQTQIRRISSLERAVEHAQ RCSSRLSNENSLKTSFRKETKVLKTLSIIMGVFVFCWLPFFVLNCMIPFCHMNLPGQNEP EPPCVSETTFNIFVWFGWANSSLNPVIYAFNADFRKAFTTILGCNRFCSSNNVEAVNFSN ELVSYHHDTTFQKDIPVTFNNSHLPNVVDQDQEVLEGTCFDKVSVLSTSHGTRSQKNLHL PAGVQFECEAEITLETITPFTSTGPLECLPQLVADEDRHYTTKLY
Uniprot No.

Target Background

Function
This is one of the five types (D1 to D5) of receptors for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain and kidney.

Q&A

How does D(1C) dopamine receptor structurally differ from other dopamine receptors in Xenopus laevis?

While D1A and D1B receptors appear to be clear homologs of their mammalian counterparts, D1C represents a novel receptor subtype. The structural differences primarily occur in the third intracellular loop and C-terminal regions, which are involved in G-protein coupling and receptor desensitization pathways. These structural variations likely contribute to the unique pharmacological profile observed with the D1C receptor, particularly its higher affinity for agonists compared to other D1-like receptors .

What expression systems are typically used for producing recombinant Xenopus laevis D(1C) dopamine receptor?

Recombinant Xenopus laevis D(1C) dopamine receptor can be produced in various expression systems, each with specific advantages for different experimental applications:

  • E. coli expression system: Commonly used for producing large quantities of the receptor for structural studies. The receptor is typically expressed with fusion tags (such as His-tag) to facilitate purification. This system is evidenced in commercially available products where the full-length protein (1-465 amino acids) is expressed in E. coli with an N-terminal His tag .

  • Mammalian cell expression (COS-7 cells): Used for functional studies and pharmacological characterization. This system allows proper folding and post-translational modifications that may be crucial for receptor function. The original characterization studies of the D1C receptor utilized COS-7 cells to evaluate receptor pharmacology and adenylate cyclase activation .

For optimal experimental outcomes, researchers should consider the intended application when selecting an expression system. Bacterial expression systems yield higher protein quantities but may lack post-translational modifications, while mammalian systems better preserve receptor functionality.

What are the pharmacological characteristics of the Xenopus laevis D(1C) dopamine receptor?

The Xenopus laevis D(1C) dopamine receptor exhibits a distinct pharmacological profile that classifies it as a D1-like receptor while showing unique properties compared to other D1 family members. Key pharmacological characteristics include:

  • Agonist binding profile: The D1C receptor displays higher affinities for most dopaminergic agonists compared to either Xenopus or mammalian D1A and D1B/D5 receptors. This includes enhanced binding of dopamine and synthetic agonists .

  • Antagonist binding profile: For antagonists, D1C exhibits binding affinities that are intermediate between those of D1A and D1B/D5 receptors .

  • Signal transduction: Like other D1 family receptors, D1C stimulates adenylate cyclase activity in response to dopamine or the synthetic agonist SKF-82526, indicating coupling to Gαs proteins .

  • Rank order of potency: While maintaining a pharmacological profile consistent with D1-like receptors, D1C shows a unique rank order of potency for various ligands compared to other D1 family members .

These distinctive pharmacological properties make the D1C receptor valuable for comparative studies and suggest potential specialization in dopaminergic signaling in amphibians.

How does the ligand binding affinity of D(1C) receptor compare with other D1 family receptors?

The Xenopus laevis D(1C) dopamine receptor demonstrates unique ligand binding characteristics that distinguish it from other D1 family members:

Receptor TypeDopamine Affinity2-amino-6,7-dihydroxytetralin AffinityAntagonist Binding
Xen D1AModerateLowerHigh specificity
Xen D1BHigh (10x higher than D1A)High (10x higher than D1A)Moderate affinity
Xen D1CHighest among D1 familyHighest among D1 familyIntermediate between D1A and D1B

The D1C receptor exhibits higher individual affinities for most agonists compared to either Xenopus or mammalian D1A and D1B/D5 receptors, making it particularly sensitive to dopaminergic stimulation. For antagonists, the D1C receptor shows binding affinities that are intermediate between those observed for D1A and D1B receptors .

This unique pharmacological profile suggests that the D1C receptor may mediate specialized dopaminergic responses in Xenopus tissues, potentially allowing for finer regulation of dopamine-dependent physiological processes.

What signaling pathways are activated by the Xenopus laevis D(1C) dopamine receptor?

The Xenopus laevis D(1C) dopamine receptor primarily signals through the canonical D1-like receptor pathway involving adenylate cyclase activation. The signaling cascade includes:

  • Adenylate cyclase stimulation: Upon dopamine binding, D1C receptors activate adenylate cyclase via Gαs coupling, leading to increased intracellular cAMP levels. This has been demonstrated experimentally with both dopamine and the synthetic agonist SKF-82526 .

  • PKA activation: The elevated cAMP levels subsequently activate protein kinase A (PKA), which phosphorylates various downstream targets.

  • DARPP-32 phosphorylation: By analogy with other D1-like receptors, D1C likely promotes phosphorylation of DARPP-32 (dopamine and cAMP-regulated phosphoprotein of 32 kDa), an important integrator of dopaminergic signaling.

  • Potential cross-talk: Though not directly demonstrated for D1C, D1-like receptors can interact with other signaling pathways, including MAPK cascades and calcium signaling.

While these pathways are consistent with the D1 receptor family, the distinct pharmacological profile of D1C suggests potential differences in signaling kinetics or pathway bias compared to D1A and D1B receptors. Further research using pathway-specific inhibitors and phosphorylation assays would help elucidate the complete signaling repertoire of the D1C receptor.

What is the tissue distribution pattern of D(1C) dopamine receptor in Xenopus laevis?

The Xenopus laevis D(1C) dopamine receptor exhibits a specific tissue distribution pattern that differs from other D1 family receptors:

Receptor TypeBrain ExpressionKidney ExpressionOther Tissues
Xen D1AYesNoLimited
Xen D1BYesYesNot well characterized
Xen D1CYesYesNot well characterized

The D1C receptor mRNA is prominently expressed in both brain and kidney tissues of Xenopus laevis. This distribution pattern differs from D1A, which appears to be expressed primarily in the brain. The D1B and D1C receptors share expression in both brain and kidney, suggesting potential functional overlap in these tissues .

The differential expression patterns of these receptor subtypes likely reflect tissue-specific requirements for dopaminergic signaling in amphibians. The presence of D1C in kidney suggests potential roles in renal physiology, possibly related to fluid and electrolyte regulation, while its brain expression indicates involvement in neural functions.

What are the hypothesized physiological roles of the D(1C) dopamine receptor in Xenopus laevis?

Based on its tissue distribution and pharmacological properties, several physiological roles have been hypothesized for the Xenopus laevis D(1C) dopamine receptor:

  • Neurotransmission: In the brain, D1C likely mediates aspects of dopaminergic neurotransmission distinct from those controlled by D1A and D1B receptors. Its higher affinity for dopamine may allow it to respond to lower neurotransmitter concentrations, potentially serving as a high-sensitivity dopamine sensor .

  • Renal function: The expression of D1C in kidney suggests roles in renal dopaminergic systems, which typically regulate sodium excretion, glomerular filtration, and blood pressure. The presence of both D1B and D1C in kidney may provide redundancy or specialization in these functions .

  • Developmental processes: By analogy with other dopamine receptors, D1C may play roles in developmental processes, potentially influencing cell migration, differentiation, or synaptogenesis during amphibian development.

  • Neuroendocrine regulation: Given dopamine's role as a neuromodulator, D1C may participate in neuroendocrine pathways unique to amphibians, possibly related to metamorphosis or environmental adaptation.

These hypothesized roles remain to be fully elucidated through targeted studies using pharmacological tools, genetic manipulation, or immunohistochemical approaches specific to the D1C receptor.

What are the recommended protocols for expressing and purifying recombinant Xenopus laevis D(1C) dopamine receptor?

For successful expression and purification of recombinant Xenopus laevis D(1C) dopamine receptor, researchers should consider the following optimized protocols:

E. coli Expression System:

  • Vector selection: Use vectors with strong inducible promoters (T7, tac) and appropriate fusion tags (His, GST) to facilitate detection and purification.

  • Expression conditions:

    • Culture bacteria at 30°C rather than 37°C to reduce inclusion body formation

    • Induce with lower IPTG concentrations (0.1-0.5 mM)

    • Express for longer periods (16-24 hours) at reduced temperatures

  • Purification strategy:

    • Solubilize membrane fractions with appropriate detergents (DDM, CHAPS)

    • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Consider adding stabilizing agents (glycerol, specific lipids) to maintain receptor conformation

Storage recommendations:

  • Store at -20°C/-80°C for extended periods

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for up to one week

  • Consider adding 5-50% glycerol as a cryoprotectant

Reconstitution protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50%

  • Aliquot for long-term storage

These protocols are designed to maximize yield while preserving the functional integrity of the receptor for downstream applications.

What analytical techniques are most effective for studying ligand binding properties of the D(1C) dopamine receptor?

Several analytical techniques have proven effective for characterizing the ligand binding properties of the Xenopus laevis D(1C) dopamine receptor:

  • Radioligand binding assays:

    • Competition binding assays using [³H]-SCH23390 (a selective D1 antagonist) as the radioligand

    • Saturation binding to determine Bmax and Kd values

    • Kinetic studies to assess association and dissociation rates

    • These assays are typically performed with membranes from cells expressing the recombinant receptor

  • Functional assays:

    • cAMP accumulation assays to measure receptor activation and G-protein coupling

    • FLIPR (Fluorometric Imaging Plate Reader) assays for calcium mobilization

    • GTPγS binding assays to directly measure G-protein activation

    • These provide information about receptor function beyond simple binding

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) for real-time binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis (MST) for binding affinity measurements with minimal protein consumption

  • Computational approaches:

    • Homology modeling based on crystal structures of related GPCRs

    • Molecular docking to predict binding modes of novel ligands

    • Molecular dynamics simulations to understand receptor conformational changes

For comprehensive characterization, researchers should employ multiple complementary techniques, as each provides different aspects of receptor-ligand interactions.

What expression systems best preserve the functional properties of the D(1C) dopamine receptor for electrophysiological studies?

For electrophysiological studies of the Xenopus laevis D(1C) dopamine receptor, certain expression systems better preserve the receptor's functional properties:

  • Mammalian cell lines:

    • HEK293 cells: Provide excellent membrane properties for patch-clamp recordings and have low endogenous channel expression

    • COS-7 cells: Previously validated for D1C receptor expression and functional studies, demonstrating proper coupling to adenylate cyclase

    • Both systems allow for transient transfection with high efficiency using lipofection or calcium phosphate methods

  • Xenopus oocytes:

    • Particularly suitable for two-electrode voltage clamp recordings

    • Allow co-expression of the receptor with relevant ion channels or effector proteins

    • Provide a homologous environment for the amphibian receptor

    • Require microinjection of receptor cRNA transcribed in vitro

  • Primary neuronal cultures:

    • Neuronal environments provide appropriate scaffolding and regulatory proteins

    • Can be transfected using viral vectors for receptor expression

    • Allow for studying receptor function in a more physiologically relevant context

For optimal results in electrophysiological studies, researchers should consider:

  • Using inducible expression systems to control receptor density

  • Co-expressing relevant G proteins or effectors if studying downstream signaling

  • Including appropriate controls for endogenous receptors

  • Maintaining consistent recording conditions (temperature, ionic composition)

The choice of expression system should be guided by the specific electrophysiological technique planned and the particular aspect of receptor function under investigation.

How does the Xenopus laevis D(1C) dopamine receptor compare evolutionarily to mammalian dopamine receptors?

The Xenopus laevis D(1C) dopamine receptor represents an evolutionarily significant member of the dopamine receptor family that provides insights into receptor diversification:

This evolutionary perspective suggests that the dopamine receptor family may be more diverse than currently recognized in mammals, with the amphibian D1C receptor potentially representing a "missing link" in dopamine receptor evolution.

What insights does the D(1C) receptor provide about the evolution of dopaminergic systems across vertebrates?

The Xenopus laevis D(1C) dopamine receptor offers several important insights into the evolution of dopaminergic signaling across vertebrates:

  • Receptor diversification: The presence of three distinct D1-like receptors in amphibians (D1A, D1B, and D1C) compared to the two well-characterized subtypes in mammals (D1/D1A and D5/D1B) suggests that receptor diversification occurred early in vertebrate evolution. Some lineages may have retained more of this diversity than others .

  • Functional specialization: The unique pharmacological profile and tissue distribution of D1C points to evolutionary specialization of dopamine receptors to meet specific physiological demands. This specialization likely reflects adaptation to different ecological niches and physiological challenges across vertebrate lineages .

  • Conservation of signaling mechanisms: Despite divergence in receptor subtypes, the core signaling mechanism through adenylate cyclase activation remains conserved, indicating the fundamental importance of this pathway in dopaminergic signaling throughout vertebrate evolution .

  • Potential for "hidden" receptor diversity: The identification of D1C in amphibians suggests that additional dopamine receptor subtypes may exist in other vertebrates, including mammals, that have yet to be identified. This possibility is supported by the observation that some dopaminergic responses in mammals cannot be fully explained by the currently known receptor repertoire .

  • Contextual adaptation: The differential expression patterns of D1 family receptors across vertebrates suggests adaptation to specific ecological contexts and physiological requirements, such as the expression of D1C in amphibian kidney, which may reflect unique aspects of amphibian osmoregulation .

These insights highlight the value of comparative studies in understanding the evolution of neurochemical systems and suggest that further exploration of non-mammalian vertebrates may reveal additional diversity in dopaminergic signaling.

How can the Xenopus laevis D(1C) dopamine receptor be used as a tool in neuropharmacological research?

The Xenopus laevis D(1C) dopamine receptor offers several valuable applications as a research tool in neuropharmacology:

  • Comparative pharmacology platform: The unique pharmacological profile of D1C makes it an excellent system for comparative studies of dopaminergic ligands. Compounds that show differential activity between D1C and mammalian receptors may reveal structural determinants of receptor selectivity and guide the development of subtype-specific drugs .

  • Model for receptor evolution: As an evolutionary distinct member of the D1 family, D1C provides a valuable comparative point for understanding receptor evolution. Chimeric receptors combining domains from D1C and mammalian receptors can help identify regions critical for specific pharmacological properties .

  • Screening system for novel ligands: The higher affinity of D1C for many dopaminergic agonists makes it a sensitive screening platform for identifying novel compounds with dopaminergic activity. This could be particularly useful for detecting compounds with weak dopaminergic effects that might be missed in screens using lower-affinity mammalian receptors .

  • Investigation of receptor-effector coupling: The D1C receptor can serve as a model system for studying the molecular determinants of G protein coupling and effector activation, potentially revealing conserved mechanisms across the dopamine receptor family .

  • Template for identifying novel mammalian receptors: The existence of D1C in amphibians provides a template for searching for additional, possibly rare or conditionally expressed, dopamine receptor subtypes in mammals .

These applications highlight the value of this unique receptor as both a research tool and a model system for understanding fundamental aspects of dopaminergic signaling.

What are the current challenges in studying the physiological relevance of the D(1C) dopamine receptor?

Researchers investigating the physiological relevance of the Xenopus laevis D(1C) dopamine receptor face several significant challenges:

  • Lack of highly selective pharmacological tools: While D1C has a distinctive pharmacological profile, there are currently no ligands that selectively target D1C over other D1-family receptors with sufficient specificity for in vivo studies. Developing such tools would require extensive medicinal chemistry efforts .

  • Limited genetic manipulation tools in Xenopus: Compared to mammalian and some other model systems, genetic manipulation techniques for Xenopus laevis are less developed, making it challenging to create receptor knockouts or knockdowns to study the specific roles of D1C in vivo.

  • Incomplete tissue and cellular expression mapping: While D1C expression has been documented in brain and kidney, detailed cellular and subcellular localization studies are lacking. This limits understanding of the specific neural circuits or renal processes in which D1C may participate .

  • Unclear relevance to human physiology: Without identified human homologs, translating findings from D1C research to human physiology and pathology remains speculative. Determining whether functionally similar receptors exist in humans is a critical challenge.

  • Complex receptor interactions: Dopamine receptors often function in heteromeric complexes with other receptors, and the potential partners for D1C remain unexplored. Understanding these interactions is essential for elucidating the receptor's true physiological roles.

  • Limited availability of research tools: Commercial antibodies and other research reagents specific for D1C are scarce, hampering immunohistochemical and biochemical studies of endogenous receptor expression and function.

Addressing these challenges will require concerted efforts in developing selective pharmacological tools, advancing genetic manipulation techniques in Xenopus, and conducting detailed expression and functional studies.

What are promising research directions for understanding potential mammalian equivalents of the D(1C) dopamine receptor?

Several promising research directions could help identify and characterize potential mammalian equivalents of the Xenopus laevis D(1C) dopamine receptor:

  • Genome mining and bioinformatics approaches: Advanced computational methods could reveal previously overlooked dopamine receptor genes or splice variants in mammalian genomes. Using the D1C sequence as a template, researchers can search for similar sequences in mammalian genomic data that may have been missed in conventional analyses .

  • Single-cell transcriptomics: High-resolution transcriptomic analyses of specific cell populations in mammalian brain and peripheral tissues may reveal rare or conditionally expressed dopamine receptor subtypes that share features with D1C. This approach is particularly powerful for identifying receptors expressed in small subpopulations of cells .

  • Pharmacological fingerprinting: Systematic characterization of dopaminergic responses in mammalian tissues that cannot be fully explained by known receptors could help identify "orphan" responses matching the pharmacological profile of D1C. This approach would focus on tissues where D1C is expressed in Xenopus, such as the kidney .

  • Functional genomics screening: CRISPR-based screens targeting predicted but uncharacterized G-protein coupled receptors in the mammalian genome could identify receptors with functional properties similar to D1C.

  • Evolutionary proteomics: Studies comparing the dopamine receptor interactomes across species could reveal conserved protein interaction networks that might help identify functional equivalents of D1C in mammals, even if the primary sequence has diverged significantly.

  • Examination of "orphan" GPCRs: Screening of currently unassigned orphan G-protein coupled receptors with dopaminergic ligands could potentially identify mammalian receptors with pharmacological profiles similar to D1C .

These approaches, particularly when used in combination, offer promising avenues for exploring the possible existence of D1C-like receptors in mammals and understanding their potential physiological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.