Recombinant Xenopus laevis D (2) dopamine receptor A

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
drd2-a; D(2 dopamine receptor A; D2R-A; D2R 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
drd2-a
Target Protein Sequence
MDPQNLSMYNDDINNGTNGTAVDQKPHYNYYAMLLTLLVFVIVFGNVLVCIAVSREKALQ TTTNYLIVSLAVADLLVATLVMPWAVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLC AISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTGSKVCIIDN PAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSRGVAVDAHKDKCTHPED VKLCSVFVKSNGSFPADKKKVILVQEAGKHPEDMEMEMMSSTSPPEKTKHKSASPDHNQL AVPATSNQCKNASLTSPVESPYKAEKNGHPKDSTKPAKVFEIQSMPNGKTRTSIKTMSKK KLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCNCNIPQALYSAFTWLGYVNSAV NPIIYTTFNVEFRKAFIKILHC
Uniprot No.

Target Background

Function
This is one of the five types (D1 to D5) of receptors for dopamine. Its activity is mediated by G proteins, which inhibits adenylyl cyclase. In Xenopus, the D2R is involved in the regulation of the melanotrope cells of the intermediate pituitary during background adaptation of the animal.
Database Links

KEGG: xla:378584

UniGene: Xl.1163

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Brain; pituitary.

Q&A

What are the structural characteristics of Xenopus laevis D(2) dopamine receptors compared to mammalian homologs?

The Xenopus laevis D(2) dopamine receptor belongs to the D2-like subfamily of dopamine receptors, which are G-protein coupled receptors characterized by seven transmembrane spanning domains with ligand-binding sites, an extracellular amino-terminus, and an intracellular carboxyl tail . While sharing fundamental structural features with mammalian D2 receptors, notable differences exist in their binding characteristics.

Comparative binding studies suggest that amphibian dopamine receptors, including those from Xenopus, fall into two classes similar to the mammalian D1 and D2 subfamilies but with slightly different binding profiles . The pharmacological rank order for affinity at D2-like receptors in amphibians (such as Rana pipiens) has been found to be spiperone > SCH-23390 > sulpiride > SKF-38393, which differs from the mammalian pattern of spiperone > sulpiride > SCH-23390 > SKF-38393 . This indicates evolutionary divergence in binding site structure while maintaining core receptor functionality.

Methodologically, researchers should approach structural characterization of Xenopus D(2) receptors through:

  • Direct binding assays using various radioligands (e.g., 3H-spiperone) to measure functional receptor interactions rather than assessing total receptor protein

  • Displacement studies with multiple ligands to determine pharmacological profiles

  • Comparative analysis with mammalian receptors using the same experimental conditions

What expression systems are most effective for recombinant Xenopus laevis D(2) dopamine receptor production?

For optimal expression of recombinant Xenopus laevis D(2) dopamine receptors, researchers should consider heterologous expression systems that maintain post-translational modifications while providing sufficient protein yields.

Common methodological approaches include:

  • Mammalian cell lines (HEK293, CHO cells): These provide proper folding and post-translational modifications, essential for functional studies. Transfection can be performed using lipid-based reagents or electroporation with plasmids containing the Xenopus D(2) receptor sequence under a strong promoter (e.g., CMV).

  • Insect cell expression systems: Baculovirus-mediated expression in Sf9 or Hi5 insect cells offers advantages for studies requiring larger protein quantities, as demonstrated with other GPCRs.

  • Xenopus oocyte expression: This homologous system is particularly valuable for electrophysiological studies of the receptor function through co-expression with appropriate G-proteins and ion channels.

When selecting an expression system, researchers should consider that D2-like dopamine receptors couple to Gα i/o proteins to inhibit adenylyl cyclase and decrease cAMP levels . Therefore, the expression system should contain appropriate G-protein coupling machinery to enable functional studies.

How can I validate the functionality of recombinant Xenopus laevis D(2) dopamine receptors?

Validation of recombinant Xenopus D(2) receptor functionality requires multiple complementary approaches:

  • cAMP inhibition assays: Since D2-like receptors are inhibitory and couple to Gi/o proteins, functionality can be assessed by measuring the reduction in forskolin-stimulated cAMP production upon receptor activation with dopamine or selective agonists. Similar to what was observed with silkworm D2-like receptors, dopamine should distinctly lower cAMP levels in cells expressing functional D(2) receptors .

  • Radioligand binding assays: Using selective D2 ligands such as [3H]-spiperone to determine binding parameters (Kd and Bmax) and compare with known values for amphibian D2 receptors.

  • Calcium mobilization assays: When co-expressed with chimeric G-proteins, D2 receptor activation can be monitored through calcium flux measurements.

  • GTPγS binding assays: To directly measure G-protein activation following receptor stimulation.

  • Electrophysiological approaches: Particularly in Xenopus oocytes, monitoring K+ channel activity through GIRK channels that are coupled to D2 receptor activation can provide functional validation.

Researchers should establish a dose-response relationship with dopamine and selective D2 agonists/antagonists, comparing pharmacological profiles with those reported for amphibian receptors .

What pharmacological differences exist between Xenopus D(2) receptors and mammalian D(2) receptors?

Significant pharmacological differences exist between amphibian and mammalian D(2) receptors that must be considered in experimental design:

  • Agonist potency: While dopamine serves as the primary endogenous ligand for both amphibian and mammalian D2 receptors, the relative potencies of synthetic agonists may differ. Comparative pharmacology studies have shown that the rank order of ligand affinities differs between amphibian and mammalian receptors .

  • Antagonist binding: Spiperone shows high affinity for both amphibian and mammalian D2 receptors, but sulpiride has significantly lower affinity for amphibian D2-like receptors compared to rat receptors . This pharmacological divergence necessitates careful selection of ligands for Xenopus receptor studies.

  • Receptor reserve and signaling efficiency: Amphibian D2 receptors may exhibit different levels of receptor reserve compared to mammalian equivalents, affecting the apparent potency of partial agonists.

LigandAffinity for Amphibian D2 ReceptorsAffinity for Rat D2 ReceptorsRelative Difference
SpiperoneHigh (but lower than rat)Very HighAmphibian < Rat
SulpirideModerateHighAmphibian << Rat
SCH-23390ModerateLowAmphibian > Rat
SKF-38393LowVery LowAmphibian ≈ Rat

Methodologically, researchers should:

  • Establish complete dose-response curves for multiple ligands

  • Calculate EC50/IC50 values to quantify differences

  • Consider potential species-specific allosteric modulators

  • Examine different signaling pathways beyond cAMP inhibition

How do splice variants of Xenopus D(2) receptors affect experimental outcomes?

Dopamine D(2) receptors in various species exist in multiple isoforms, including short (D2S) and long (D2L) variants, which differ by the presence of additional amino acids within the third intracellular loop . While specific information about Xenopus D(2) receptor splice variants is limited in the provided search results, researchers should consider the following methodological approaches:

  • Variant identification: Use RT-PCR with primers flanking potential splice regions to identify different mRNA transcripts from Xenopus tissues.

  • Selective expression: Create expression constructs for each identified variant for comparative studies.

  • Functional comparison: Compare G-protein coupling, cAMP inhibition, and β-arrestin recruitment between variants.

  • Tissue distribution analysis: Determine the relative expression of different variants across tissues using quantitative PCR.

The third intracellular loop is involved in G-protein coupling, so different splice variants can couple to distinct G-proteins, potentially leading to different signaling outcomes . For example, in mammals, the D2S receptor has a higher affinity for dopamine and more effectively inhibits adenylyl cyclase than D2L . Similar differences might exist between Xenopus D(2) receptor variants.

What are the key considerations for developing selective antibodies against Xenopus laevis D(2) dopamine receptors?

Developing selective antibodies against Xenopus D(2) receptors requires careful consideration of several factors:

  • Epitope selection: Choose receptor regions that:

    • Are unique to Xenopus D(2) receptors (avoiding conserved domains shared with other GPCRs)

    • Are predicted to be accessible (extracellular N-terminus or extracellular loops)

    • Have low sequence homology with other dopamine receptor subtypes

  • Cross-reactivity testing: Validate antibody specificity against:

    • Other Xenopus dopamine receptor subtypes (D1, D3, D4, D5)

    • Mammalian D(2) receptors (to assess species specificity)

    • Other GPCRs with similar structural elements

  • Validation strategies:

    • Western blotting using recombinant receptor and native tissue

    • Immunoprecipitation followed by mass spectrometry

    • Immunocytochemistry with transfected and non-transfected cells

    • Knockout or knockdown controls

  • Selection of immunization approach:

    • Consider synthetic peptides for epitope-specific antibodies

    • Use purified recombinant receptor fragments for broader recognition

    • Employ genetic immunization strategies for conformational epitopes

The limited availability of receptor (due to low expression levels of GPCRs) and potential cross-reactivity with other dopamine receptor subtypes are significant challenges that must be addressed methodically.

How can molecular dynamics simulations inform ligand design for Xenopus D(2) dopamine receptors?

Molecular dynamics (MD) simulations can provide valuable insights for rational drug design targeting Xenopus D(2) receptors through several methodological approaches:

  • Homology model development:

    • Create a Xenopus D(2) receptor model based on available crystal structures of mammalian D2 or D3 receptors

    • Refine the model through energy minimization and validation with known ligand interactions

    • Focus particularly on binding pocket residues that differ between amphibian and mammalian receptors

  • Ligand binding simulations:

    • Perform docking studies comparing known D2 agonists and antagonists

    • Calculate binding energies and identify key interaction residues

    • Identify amphibian-specific binding pocket features that could be exploited for selective ligand design

  • Receptor dynamics analysis:

    • Simulate receptor conformational changes upon ligand binding

    • Identify differences in activation mechanisms between Xenopus and mammalian receptors

    • Explore allosteric binding sites unique to amphibian receptors

  • Structure-based ligand design:

    • Design virtual compound libraries targeting Xenopus-specific binding pocket features

    • Perform virtual screening to identify candidates with predicted selectivity

    • Optimize lead compounds through iterative simulation and modification

  • Signaling pathway simulations:

    • Model receptor-G protein interactions based on intracellular loop differences

    • Predict biased signaling properties of different ligands

The pharmacological differences observed between amphibian and mammalian D2 receptors suggest structural differences in binding pockets that could be exploited through computational approaches to develop species-selective compounds.

What insights can comparative analysis of Xenopus and mammalian D(2) receptors provide about dopamine receptor evolution?

Comparative analysis of Xenopus and mammalian D(2) receptors offers valuable insights into evolutionary aspects of dopamine signaling:

  • Phylogenetic analysis approaches:

    • Construct comprehensive phylogenetic trees incorporating D2 receptors from diverse species

    • Analyze evolutionary rates across different receptor domains

    • Identify conserved versus divergent receptor regions

Phylogenetic evidence suggests that dopamine receptors likely appeared before the cnidarian divergence, with distinct D1-like and D2-like classes forming prior to the separation of deuterostomes and protostomes . Amphibian receptors like those in Xenopus represent an important evolutionary intermediate.

  • Selection pressure analysis:

    • Calculate dN/dS ratios across different receptor domains to identify regions under positive or purifying selection

    • Compare evolutionary constraints between ligand binding regions and intracellular signaling domains

    • Identify species-specific adaptations in receptor structure

  • Functional conservation studies:

    • Compare G-protein coupling efficiency across species

    • Analyze conservation of key regulatory mechanisms (desensitization, internalization)

    • Examine downstream signaling pathway conservation

  • Methodological approaches:

    • Ancestral state reconstruction to infer properties of evolutionary precursors

    • Site-directed mutagenesis to convert amphibian-specific residues to mammalian counterparts

    • Chimeric receptor studies to identify domains responsible for functional differences

The documented differences in pharmacological profiles between amphibian and mammalian D2 receptors provide valuable starting points for such evolutionary investigations.

How do post-translational modifications affect Xenopus D(2) receptor function and what methodologies can assess these modifications?

Post-translational modifications (PTMs) significantly impact GPCR function, and their investigation in Xenopus D(2) receptors requires specialized methodological approaches:

  • Phosphorylation analysis:

    • Mass spectrometry-based phosphoproteomics to identify phosphorylation sites

    • Phospho-specific antibodies to monitor site-specific phosphorylation

    • Mutagenesis of putative phosphorylation sites to assess functional consequences

    • In vitro kinase assays to identify responsible kinases (GRKs, PKA, PKC)

  • Palmitoylation studies:

    • Metabolic labeling with palmitate analogs

    • Click chemistry approaches for palmitoylation detection

    • Acyl-biotin exchange methods

    • Functional consequences of preventing palmitoylation through site-directed mutagenesis

  • Glycosylation analysis:

    • Enzymatic deglycosylation combined with Western blotting

    • Lectin binding assays to characterize glycan structures

    • Site-directed mutagenesis of N-linked glycosylation sites

    • Mass spectrometry characterization of glycan structures

  • Ubiquitination and SUMOylation:

    • Immunoprecipitation with ubiquitin/SUMO antibodies

    • Expression of tagged ubiquitin/SUMO proteins

    • Proteasomal inhibition studies to assess degradation pathways

  • Integrated PTM profiling:

    • Combine multiple PTM detection methods to create a comprehensive PTM map

    • Correlate modifications with receptor activation states

    • Compare PTM patterns between Xenopus and mammalian receptors

These modifications can regulate receptor trafficking, signaling bias, desensitization, and internalization. Unlike simple binding parameters, PTMs may explain species-specific differences in signaling dynamics and receptor regulation.

What are the optimal conditions for solubilizing and purifying recombinant Xenopus D(2) dopamine receptors?

Solubilizing and purifying GPCRs like the Xenopus D(2) receptor presents significant technical challenges due to their hydrophobicity and instability when removed from the membrane environment. Researchers should consider the following methodological approaches:

  • Membrane preparation:

    • Harvest expressing cells (typically from mammalian or insect cell expression systems)

    • Disrupt cells using nitrogen cavitation or mechanical homogenization

    • Separate membranes through differential centrifugation

    • Wash membranes to remove peripheral proteins

  • Receptor stabilization strategies:

    • Include high-affinity ligands during purification to stabilize receptor conformation

    • Consider adding cholesterol or specific lipids to maintain receptor stability

    • Use thermostabilizing mutations if structural integrity is compromised during purification

  • Detergent selection:

    • Test multiple detergents (DDM, LMNG, CHAPS, digitonin) at various concentrations

    • Consider detergent mixtures that better mimic the native membrane environment

    • Evaluate solubilization efficiency and receptor functionality for each condition

    • Monitor receptor stability over time in different detergents

  • Affinity purification approaches:

    • Add affinity tags (His, FLAG, etc.) to receptor termini (typically C-terminus)

    • Use ligand-based affinity chromatography for native receptor

    • Implement two-step purification strategies for higher purity

  • Alternative solubilization strategies:

    • Nanodiscs or SMALPs (styrene-maleic acid lipid particles) to maintain lipid environment

    • Amphipols to stabilize the receptor after initial detergent solubilization

    • Bicelles as intermediate between detergent micelles and lipid bilayers

Purification success should be assessed through binding assays to confirm that the receptor retains its pharmacological properties throughout the purification process.

What experimental approaches can resolve conflicting pharmacological data for Xenopus D(2) receptors?

When confronted with conflicting pharmacological data for Xenopus D(2) receptors, researchers should implement a systematic troubleshooting and validation approach:

  • Standardized expression systems:

    • Compare receptor properties across multiple expression systems (mammalian, insect, Xenopus oocytes)

    • Verify receptor sequence identity between studies

    • Quantify expression levels to account for receptor density effects on apparent pharmacology

  • Multiple assay platforms:

    • Implement orthogonal assays measuring different aspects of receptor function:

      • Binding assays (saturation, competition, kinetics)

      • G-protein activation (GTPγS binding, BRET-based assays)

      • Second messenger production (cAMP inhibition, Ca2+ mobilization)

      • β-arrestin recruitment

      • Receptor internalization

  • Rigorous pharmacological characterization:

    • Establish complete concentration-response curves

    • Determine both potency (EC50/IC50) and efficacy parameters

    • Test multiple reference compounds with well-established pharmacology

    • Apply operational models to quantify signaling efficacy and receptor reserve

  • Addressing procedural variables:

    • Standardize assay conditions (temperature, buffer composition, incubation times)

    • Account for ligand solubility issues and compound stability

    • Control for potential allosteric modulators in the experimental system

    • Consider receptor phosphorylation state and coupling efficiency

  • Collaborative cross-validation:

    • Establish multi-laboratory studies using identical receptor constructs and compounds

    • Implement blinded testing protocols to eliminate bias

    • Share raw data and detailed methodological information

By systematically controlling these variables, researchers can determine whether conflicting data stem from genuine receptor properties (splice variants, post-translational modifications) or methodological differences.

How can CRISPR-Cas9 genome editing be optimized for studying Xenopus D(2) receptor function in vivo?

CRISPR-Cas9 genome editing offers powerful approaches for investigating Xenopus D(2) receptor function in vivo, but requires optimization for this specific application:

  • Guide RNA design strategies:

    • Design multiple sgRNAs targeting conserved exons of the Xenopus D(2) receptor gene

    • Perform in silico off-target prediction specific to the Xenopus genome

    • Target regions encoding critical receptor domains (ligand binding, G-protein coupling)

    • Consider creating specific mutations rather than complete knockouts to study receptor function

  • Delivery methods for Xenopus embryos:

    • Microinjection of Cas9 protein and sgRNA complexes at the one-cell stage

    • Optimize Cas9:sgRNA ratios to maximize editing efficiency while minimizing toxicity

    • Consider tissue-specific or inducible Cas9 expression for temporal control

    • Implement F0 screening strategies to identify successful editing events

  • Validation approaches:

    • T7 endonuclease I assay or Surveyor assay for initial editing confirmation

    • Deep sequencing to characterize the spectrum of induced mutations

    • RT-PCR and Western blotting to confirm altered receptor expression

    • Pharmacological validation using D2 agonists/antagonists

  • Phenotypic analysis methods:

    • Behavioral assays to assess locomotor activity and other dopamine-dependent behaviors

    • Electrophysiological recordings from dopaminergic circuits

    • Calcium imaging in relevant neural tissues

    • Molecular analysis of downstream signaling pathways

  • Advanced genetic strategies:

    • Knock-in approaches to create tagged receptors for localization studies

    • Conditional knockout strategies using Cre-lox systems

    • Rescue experiments with wild-type or mutant receptor variants

    • Humanized receptor models to study mammalian receptor properties in vivo

These approaches can be particularly valuable for studying D2 receptor function in development and neurological processes, as dopamine receptors are involved in the control of locomotion, cognition, emotion, and neuroendocrine signaling .

How can Xenopus D(2) receptor systems be used to screen for novel neuropsychiatric therapeutics?

The Xenopus D(2) receptor system offers unique advantages as a screening platform for novel neuropsychiatric therapeutics:

  • High-throughput screening methodologies:

    • Stable cell lines expressing Xenopus D(2) receptors coupled to reporter systems

    • FRET/BRET-based assays monitoring receptor-G-protein interactions

    • Automated patch-clamp systems for electrophysiological screening

    • Label-free technologies (impedance, DMR) for integrated cellular responses

  • Comparative pharmacology advantages:

    • Screen compounds against both amphibian and mammalian receptors in parallel

    • Identify structural determinants of species selectivity

    • Leverage pharmacological differences to discover novel binding modes

    • Use evolutionary divergence to identify conserved (likely essential) binding interactions

  • Target validation approaches:

    • Correlate in vitro potency with in vivo efficacy in Xenopus models

    • Test compounds in Xenopus behavioral assays relevant to psychiatric disorders

    • Utilize CRISPR-modified Xenopus with altered D(2) receptors as disease models

    • Perform electrophysiological validation in Xenopus brain slices

  • Specialized screening strategies:

    • Biased signaling screens to identify functionally selective ligands

    • Allosteric modulator discovery focusing on non-conserved receptor regions

    • Screens for compounds affecting receptor trafficking or desensitization

    • Combination screens with other neurotransmitter receptors

The unique pharmacological profile of amphibian D(2) receptors provides opportunities to discover compounds with novel mechanisms of action that might be overlooked in mammalian-only screening approaches.

What are the best approaches for studying D(2) receptor-G protein coupling specificity in Xenopus systems?

Investigating D(2) receptor-G protein coupling specificity in Xenopus systems requires specialized methodological approaches:

  • BRET/FRET-based approaches:

    • Generate fusion constructs of Xenopus D(2) receptors and various G-protein subunits with appropriate donor/acceptor pairs

    • Measure energy transfer upon receptor activation as indicator of coupling

    • Perform dose-response studies with various agonists to assess coupling efficiency

    • Compare coupling profiles with mammalian D(2) receptors

  • GTPγS binding assays:

    • Prepare membranes from cells expressing Xenopus D(2) receptors

    • Measure [35S]GTPγS incorporation upon receptor activation

    • Use G-protein selective antibodies to immunoprecipitate specific G-protein subtypes

    • Quantify relative coupling efficiency to different G-protein subtypes

  • G-protein selective signaling readouts:

    • Monitor Gαi/o coupling through cAMP inhibition assays

    • Assess Gβγ-mediated signaling through GIRK channel activation

    • Examine potential coupling to Gαq/11 through calcium mobilization

    • Investigate Gα12/13 coupling through RhoA activation assays

  • Structural and mutational analysis:

    • Generate mutations in intracellular loops and C-terminus to identify coupling determinants

    • Create chimeric receptors exchanging intracellular domains between Xenopus and mammalian receptors

    • Perform molecular dynamics simulations of receptor-G protein interfaces

    • Use peptide competition assays to identify key interaction motifs

D2-like receptors primarily couple to Gαi/o proteins , but species-specific differences in coupling efficiency or secondary coupling to other G-protein subtypes may exist and provide valuable insights into receptor function and regulation.

How can combining optogenetic approaches with Xenopus D(2) receptor studies advance neurobiological research?

Integrating optogenetics with Xenopus D(2) receptor studies creates powerful research opportunities:

  • Optogenetic receptor engineering approaches:

    • Develop light-controlled Xenopus D(2) receptor variants (OptoXR approach)

    • Create chimeric receptors combining vertebrate rhodopsin with Xenopus D(2) intracellular domains

    • Implement photoswitchable tethered ligands for temporal control of receptor activation

    • Design DREADD-like Xenopus D(2) receptor variants with altered ligand specificity

  • Circuit mapping methodologies:

    • Express channelrhodopsin in specific Xenopus neuronal populations

    • Simultaneously monitor D(2) receptor-mediated responses using fluorescent sensors

    • Combine optical stimulation with electrophysiological recording

    • Implement all-optical approaches (stimulation + recording) in Xenopus neural preparations

  • Developmental neurobiology applications:

    • Temporally precise control of D(2) receptor signaling during critical developmental windows

    • Cell-specific manipulation of dopaminergic pathways during neurogenesis

    • Optogenetic dissection of D(2) receptor involvement in neural circuit formation

    • Combining with in vivo imaging to visualize structural and functional consequences

  • Behavioral neuroscience approaches:

    • Wireless optogenetic stimulation during free-swimming behavior

    • Closed-loop systems triggering receptor activation based on behavioral readouts

    • Comparative studies between optogenetic manipulation and pharmacological D(2) receptor modulation

    • Investigation of timing-dependent effects of D(2) receptor activation

These integrated approaches can leverage the experimental advantages of the Xenopus model (external development, accessibility for imaging, defined neural circuits) while providing unprecedented precision in manipulating dopaminergic signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.