Recombinant Xenopus laevis D (2) dopamine receptor B

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

  • Signaling Pathways: Couples primarily with Gi/o proteins, inhibiting adenylyl cyclase and reducing cAMP levels. Demonstrated in Xenopus melanophores, where receptor activation triggers pigment aggregation via cAMP suppression .

  • Pharmacological Profile:

    • Agonists: Dopamine, quinpirole (EC50 ~nM range) .

    • Antagonists: Spiperone, sulpiride (IC50 lower for D2 receptors vs. D3) .

    • Pertussis toxin sensitivity confirms Gi-protein dependency .

Neuroendocrine Studies

  • Background Adaptation: Regulates melanotrope cells in Xenopus pituitary, controlling α-MSH release during skin color change. Chronic dopamine exposure downregulates receptor mRNA in white-adapted animals .

  • Receptor Dynamics: Stable expression in heterologous systems (e.g., Xenopus oocytes) enables functional assays measuring Cl⁻ influx or cAMP modulation .

Disease Modeling

  • Mutation Analysis: The Val154Ile mutation in conserved transmembrane domains disrupts receptor-G protein interactions, linked to movement disorders in humans. Recombinant Xenopus receptors aid cross-species mechanistic studies .

Comparative Analysis with Mammalian D2 Receptors

FeatureXenopus D2 Receptor BMammalian D2 Receptors
IsoformsSingle gene product (no splicing) D2S and D2L via alternative splicing
Expression in BrainModerate (pituitary > brain) High (striatum, midbrain)
Agonist AffinityLower for synthetic ligands Higher for benzamides (e.g., eticlopride)
G-protein CouplingGi/o (bumetanide-insensitive Cl⁻ influx) Gi/o (D2S) and Gs (D2L)

Key Research Findings

  1. Gene Expression Regulation: Dopamine suppresses drd2-b transcription in melanotropes via chronic receptor activation, suggesting feedback control .

  2. Functional Assays:

    • Recombinant receptors expressed in melanophores show dose-dependent pigment aggregation (EC50 ~10⁻⁷ M for dopamine) .

    • Oocyte systems reveal Cl⁻ flux via Na⁺/K⁺/2Cl⁻ cotransporters, highlighting ion signaling roles .

  3. Evolutionary Conservation: Transmembrane domains (e.g., Val154) are 100% conserved from amphibians to primates, underscoring structural-functional constraints .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
drd2-b; D(2 dopamine receptor B; D2R-B; D2R 2; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
drd2-b
Target Protein Sequence
EWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISV VWVLSFAISCPLLFGLNNTASTVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRK RRKRVNTKRNSHGVGVDAHKDKCTHPEDVKLCAVFVKSNGSFPAEKKKVEAGNHPEDMEM EMMSSTSPPEKTKHKSASPEHQLAVPATSNQCNNVNLPTPVNSPYKAENNGHSKDSTQPA KVFEIQSMPNGKTRTSIKTMSKRKISQHKEKKATQMLAIVLGVFIICWLPFFITHILNMH CNCNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC
Uniprot No.

Target Background

Function
This receptor belongs to one of the five types (D1 to D5) of dopamine receptors. The activity of this receptor is mediated by G proteins, which inhibit adenylyl cyclase. In Xenopus, the D2R is involved in the regulation of the melanotrope cells of the intermediate pituitary during background adaptation of the animal.
Database Links

UniGene: Xl.1165

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Brain; pituitary.

Q&A

What is Recombinant Xenopus laevis D(2) dopamine receptor B?

Recombinant Xenopus laevis D(2) dopamine receptor B is a G protein-coupled receptor encoded by the drd2-b gene (also referred to as drd2.S) in the African clawed frog. This receptor is part of the D2-like dopamine receptor family and exists as a recombinant protein produced in various expression systems including E. coli, yeast, baculovirus, and mammalian cells. The receptor typically achieves greater than or equal to 85% purity when determined by SDS-PAGE methods . The drd2-b gene has several alternative names including d2r, d2dr, drd2, and is sometimes referred to as "dopamine receptor D2 S homeolog" in scientific literature .

How does Xenopus D(2) dopamine receptor B differ from mammalian D2 receptors?

The Xenopus D2 receptor has been found to be pharmacologically distinct from its mammalian counterparts despite structural similarities. While it maintains the characteristic pharmacological profile of a D2-like receptor, studies have revealed differences in ligand binding properties and signal transduction mechanisms . These differences make the Xenopus receptor valuable for comparative studies. Unlike mammals where alternative splicing generates two molecular forms (D2S and D2L), Xenopus expresses two distinct D2 receptor genes encoding large isoform variants, both displaying high sequence identity with mammalian counterparts but with unique pharmacological properties .

What are the gene expression patterns of D2 dopamine receptors in Xenopus laevis?

In Xenopus laevis, D2 receptor expression shows tissue specificity that differs from the D1 receptor family. While members of the D1 receptor family (D1A, D1B, and D1C) show differential distribution with all three expressed in brain and only D1B and D1C expressed in kidney , the D2 receptor genes are expressed in brain tissue and also play important roles in the intermediate pituitary, particularly in melanotrope cells involved in background adaptation responses . The expression levels of the two D2 receptor genes in Xenopus are approximately equivalent, suggesting equally important functional roles .

What are the key structural features of Xenopus D(2) dopamine receptor B?

Xenopus D(2) dopamine receptor B belongs to the G protein-coupled receptor superfamily, characterized by seven transmembrane domains. Based on molecular characterization studies, Xenopus has two D2 receptor genes, both corresponding to the large isoform (D2L) variant found in mammals . The receptor contains the conserved binding domains required for dopamine recognition and interaction with G proteins, particularly in the third cytoplasmic loop which is crucial for G-protein coupling. Structural analysis reveals high sequence homology with mammalian D2 receptors, especially in the transmembrane regions and ligand-binding domains, while exhibiting species-specific variations that contribute to its unique pharmacological profile .

How do the D2 receptor isoforms in Xenopus laevis compare functionally?

Xenopus laevis expresses two structurally different D2 dopamine receptors from separate genes rather than through alternative splicing as observed in mammals. Both receptors correspond to the large isoform (D2L) variant and display comparable levels of expression . Unlike in mammals where D2S predominantly functions as an autoreceptor regulating dopamine neuron activity and D2L serves as a postsynaptic heteroreceptor, the functional specialization of the two Xenopus D2 receptors appears to be determined by their differential tissue expression patterns rather than structural variations within a single gene . This distinct evolutionary strategy for dopaminergic signaling diversification makes Xenopus an intriguing model for comparative receptor pharmacology studies.

What is the role of D2 dopamine receptors in visual function in Xenopus?

D2 dopamine receptors play a crucial role in modulating rod-cone coupling in the Xenopus retina. Through intracellular recording studies of rod photoreceptors, researchers have demonstrated that D2 receptor activation via agonists like quinpirole (10 μM) increases coupling between rods and cones, whereas D2 antagonists such as spiperone (5 μM) completely suppress this coupling . This modulation occurs specifically through D2 receptors, as D1 dopamine ligands showed no effect on rod-cone coupling. Electron microscopy confirms this functional relationship, revealing that approximately 10% of rods have direct connections to cones, creating an extensive network for signal transmission that can be modulated by dopaminergic signaling .

What expression systems are recommended for producing recombinant Xenopus D(2) dopamine receptor B?

Recombinant Xenopus laevis D(2) dopamine receptor B can be successfully produced in multiple expression systems, each with distinct advantages depending on research objectives. The primary systems include:

Expression SystemAdvantagesTypical PurityApplications
E. coliHigh yield, economical, rapid production≥85% by SDS-PAGEStructural studies, antibody production
YeastPost-translational modifications, higher eukaryotic processing≥85% by SDS-PAGEFunctional studies, ligand binding assays
BaculovirusAdvanced post-translational modifications, high expression levels≥85% by SDS-PAGEProtein-protein interaction studies
Mammalian CellNative-like processing, complex glycosylation≥85% by SDS-PAGESignaling studies, drug screening
Cell-Free ExpressionRapid production, avoids cellular toxicity issues≥85% by SDS-PAGEQuick screening, structural analysis

The choice of expression system should be guided by the specific experimental requirements, particularly whether native-like post-translational modifications are essential for the study being conducted .

What techniques are most effective for studying D2 receptor-mediated coupling between neurons?

For studying D2 receptor-mediated coupling between neurons, particularly in systems like the rod-cone network in Xenopus retina, several complementary techniques have proven effective:

  • Intracellular recording with light stimulation: This technique allows for real-time measurement of electrical responses in photoreceptors to sinusoidally modulated light at various temporal frequencies (1-4 Hz), enabling detection of signal transmission between different cell types .

  • Pharmacological manipulation: Applying selective D2 agonists (e.g., quinpirole at 10 μM) or antagonists (e.g., spiperone at 5 μM) while recording responses helps establish receptor-specific effects on neural coupling .

  • Tracer diffusion studies: Injection of small molecular tracers like neurobiotin into single cells followed by detection in neighboring cells provides direct evidence of gap junction-mediated coupling and its modulation by receptor activation .

  • Electron microscopy: This approach allows visualization and quantification of gap junctions between different cell types, providing structural evidence to complement functional data .

These techniques, used in combination, provide robust evidence for receptor-mediated modulation of neuronal coupling.

How can researchers effectively compare pharmacological profiles between Xenopus and mammalian D2 receptors?

To effectively compare pharmacological profiles between Xenopus and mammalian D2 receptors, researchers should implement a systematic approach:

  • Heterologous expression: Express both Xenopus and mammalian D2 receptors in identical cell lines (e.g., COS-7 cells) to eliminate system-specific variables .

  • Radioligand binding assays: Perform competitive binding assays using a standard radioligand and test compounds to determine binding affinities (Ki values) across a panel of agonists and antagonists .

  • Functional assays: Measure downstream signaling effects such as inhibition of adenylate cyclase activity or G-protein activation in response to various ligands .

  • Data analysis: Generate complete pharmacological profiles including:

    • Rank order of potency for multiple ligands

    • Comparison of absolute affinity values (Ki)

    • Efficacy measures for functional responses

    • Species-specific binding characteristics

When conducting these comparisons, researchers should include reference compounds with well-characterized pharmacology in both species to serve as internal controls .

How do D2 autoreceptors differ from D2 heteroreceptors in Xenopus compared to mammals?

Both Xenopus D2 receptors correspond to the large isoform variant found in mammals, suggesting a different evolutionary strategy for distinguishing auto- and heteroreceptor functions . This difference becomes especially relevant when using Xenopus as a model system for studying dopaminergic signaling or when interpreting pharmacological data. Unlike in mammals where D2L knockout preserves autoreceptor function due to continued D2S expression , targeted disruption of a single D2 receptor gene in Xenopus would likely produce different phenotypic outcomes due to the distinct genetic basis of receptor diversity.

What are the implications of the unique D1 receptor family in Xenopus for understanding dopaminergic signaling evolution?

The discovery of three distinct genes encoding D1-like dopamine receptors in Xenopus laevis (D1A, D1B, and D1C) provides significant insights into the evolution of dopaminergic signaling systems. While D1A and D1B appear to be homologues of mammalian D1/D1A and D5/D1B receptors respectively, the D1C receptor represents a unique receptor subtype with equal sequence identity to both mammalian subtypes .

This finding has several important implications:

  • Evolutionary divergence: The existence of D1C suggests that an ancestral receptor gene duplicated before the divergence of amphibians and mammals, with subsequent loss of the D1C gene in the mammalian lineage.

  • Pharmacological diversity: The Xenopus D1C receptor shows distinct pharmacological properties, with higher affinities for most agonists than either D1A or D1B receptors, while maintaining antagonist affinities intermediate between D1A and D1B .

  • Functional specialization: The differential tissue distribution of these receptors (all three in brain, only D1B and D1C in kidney) suggests evolutionary pressures driving tissue-specific functions .

  • Implications for mammalian research: The existence of D1C strongly supports the hypothesis that additional D1-like receptor subtypes may exist in mammals but remain unidentified, potentially explaining some pharmacological heterogeneity observed in mammalian systems .

How can computational models help predict species-specific dopamine receptor pharmacology?

Computational modeling approaches can significantly enhance our understanding of species-specific dopamine receptor pharmacology, particularly when comparing Xenopus and mammalian receptors. These methods complement experimental approaches by:

  • Homology modeling: Using known mammalian receptor structures as templates, researchers can generate 3D models of Xenopus receptors to identify critical amino acid differences in binding pockets that may explain pharmacological differences .

  • Molecular dynamics simulations: These can reveal how ligands interact differently with Xenopus vs. mammalian receptors, providing atomic-level insights into binding mechanisms and conformational changes.

  • Quantitative structure-activity relationship (QSAR) models: By correlating structural features of ligands with their binding affinities across species, researchers can develop predictive models for screening novel compounds.

  • Network modeling: In systems like the retina, where D2 receptors modulate complex cellular networks, computational models can integrate electrophysiological and anatomical data to predict how receptor activation affects system-level functions .

For example, a semiquantitative model of gap junction coupling based on electron microscopic measurements of junction size, distribution, conductance, and open times has provided support for the hypothesis that cone signals enter the rod network through a minority of rods with strong cone connections . This demonstrates how computational approaches can validate hypotheses derived from experimental observations.

What are common challenges in heterologous expression of Xenopus D2 receptors and how can they be addressed?

Heterologous expression of Xenopus D2 receptors presents several challenges that researchers should anticipate and address:

ChallengeManifestationSolution
Low expression levelsPoor signal in binding or functional assaysOptimize codon usage for expression system; use stronger promoters; consider inducible expression systems
Improper foldingAggregation; retention in ERReduce expression temperature; include molecular chaperones; use eukaryotic expression systems for complex GPCRs
Post-translational modificationsLack of glycosylation or phosphorylationSelect mammalian or insect cell systems that provide appropriate modifications
Membrane targeting issuesCytoplasmic retentionInclude targeting sequences; use fusion tags that enhance membrane localization
Constitutive activityHigh baseline signalingUse inverse agonists in culture medium; incorporate mutations that reduce constitutive activity
Species-specific G-protein couplingPoor functional responsesCo-express appropriate G-protein subunits from the same species

When troubleshooting expression problems, a systematic approach comparing expression levels across multiple systems is recommended, as different receptors may perform optimally in different contexts. For instance, while E. coli systems may provide high protein yields, mammalian cell expression might be necessary for proper receptor function in signaling assays .

How can researchers distinguish between direct and indirect effects in D2 receptor coupling studies?

When studying D2 receptor-mediated coupling, particularly in complex systems like the retina, distinguishing direct from indirect effects requires careful experimental design:

  • Pharmacological specificity: Use multiple, structurally diverse D2-selective agonists and antagonists. If all D2-selective compounds produce consistent effects while D1-selective compounds do not (as observed in rod-cone coupling studies), this supports direct D2 involvement .

  • Concentration-response relationships: Establish complete concentration-response curves to ensure effects occur at concentrations consistent with receptor pharmacology.

  • Temporal analysis: Direct receptor effects typically occur more rapidly than indirect effects involving multiple signaling steps.

  • Genetic approaches: Use receptor knockout models or RNA interference to confirm receptor specificity.

  • Isolated systems: When possible, use simplified preparations where confounding networks are eliminated.

  • Combination approaches: For example, in studies of D2-mediated rod-cone coupling, researchers combined electrophysiological measurements, tracer diffusion studies, and electron microscopic analysis to establish that the effects were indeed mediated by gap junctions modulated by D2 receptors .

  • Second messenger manipulation: Bypass receptor activation by directly manipulating downstream messengers (e.g., cAMP) to determine if effects are consistent with known D2 signaling pathways .

What quality control measures are essential when working with recombinant Xenopus D2 receptors?

To ensure reliable and reproducible results when working with recombinant Xenopus D2 dopamine receptors, researchers should implement the following quality control measures:

  • Purity assessment: Verify protein purity (≥85%) using SDS-PAGE and more sensitive techniques like silver staining or Western blotting with specific antibodies .

  • Identity confirmation: Confirm receptor identity through:

    • Mass spectrometry analysis

    • N-terminal sequencing

    • Immunoreactivity with D2-specific antibodies

  • Functional validation: Assess receptor functionality through:

    • Ligand binding assays using established D2 ligands

    • G-protein coupling assays

    • Downstream signaling measurements (e.g., cAMP inhibition)

  • Stability testing: Evaluate receptor stability under various storage conditions and after freeze-thaw cycles.

  • Batch consistency: Maintain consistent expression and purification protocols, with quality checks between batches.

  • Contaminant testing: Screen for endotoxins when using bacterial expression systems, particularly for in vivo applications.

  • Pharmacological fingerprinting: Generate a pharmacological profile with reference compounds to verify that the receptor displays the expected rank order of potency characteristic of D2 receptors .

These measures help ensure that experimental outcomes reflect true receptor properties rather than artifacts from compromised receptor quality.

How might research on Xenopus D2 receptors inform development of selective dopaminergic drugs?

Research on Xenopus D2 receptors provides unique insights that could accelerate the development of selective dopaminergic drugs through comparative pharmacology approaches. The distinct pharmacological profiles of Xenopus D2 receptors compared to their mammalian counterparts offer a valuable tool for understanding structure-activity relationships in dopamine receptor ligands . By identifying compounds with differential affinities between species, researchers can pinpoint structural features of ligands that interact with specific receptor domains.

Additionally, the presence of pharmacologically distinct but structurally related receptors within Xenopus (D2A and D2B) and between species creates a natural array of variants for comparative binding studies . This evolutionary diversity can help identify conserved binding sites that might be essential for receptor function versus variable regions that could be targeted for subtype selectivity. Such knowledge is invaluable for rational drug design approaches aimed at developing compounds with improved selectivity profiles for specific D2 receptor subtypes or functions.

What emerging technologies might advance Xenopus D2 receptor research in the next decade?

Several emerging technologies are poised to transform research on Xenopus D2 dopamine receptors:

  • Cryo-electron microscopy: This rapidly advancing technique could provide high-resolution structures of Xenopus D2 receptors in different activation states, revealing species-specific structural determinants of function.

  • CRISPR-Cas9 genome editing: Creation of receptor knockouts or knock-ins in Xenopus will enable precise investigation of receptor function in native tissues.

  • Optogenetic and chemogenetic tools: Development of Xenopus-specific tools for controlling D2 receptor-expressing neurons will facilitate in vivo studies of receptor function in neural circuits.

  • Advanced imaging technologies: Super-resolution microscopy and techniques like lattice light-sheet microscopy could reveal receptor organization and dynamics at unprecedented resolution.

  • Artificial intelligence approaches: Machine learning algorithms could identify subtle patterns in receptor-ligand interactions across species, potentially uncovering new pharmacological principles.

  • Organ-on-chip technologies: Microfluidic systems mimicking complex dopaminergic networks could allow controlled studies of receptor function in physiologically relevant contexts.

These technologies, combined with the unique advantages of the Xenopus model system, promise to provide deeper insights into dopamine receptor biology with broad implications for understanding neurological and psychiatric disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.