Recombinant Xenopus laevis Diacylglycerol O-acyltransferase 2 (dgat2)

Shipped with Ice Packs
In Stock

Description

General Information

Diacylglycerol O-acyltransferases (DGATs) are enzymes that catalyze the final step in the synthesis of triglycerides (TAGs), where diacylglycerol is covalently bonded to a long-chain fatty acyl-CoA in eukaryotic organisms . There are at least 74 DGAT2 sequences identified from 61 organisms . Recombinant Xenopus laevis 2-acylglycerol O-acyltransferase 2-A(mogat2-a) Protein, His-Tagged, is a full-length protein (1-335aa) fused to an N-terminal His tag and expressed in E. coli .

Synonyms

  • mogat2-a

  • 2-acylglycerol O-acyltransferase 2-A

  • Acyl-CoA:monoacylglycerol acyltransferase 2-A

  • MGAT2-A

  • Monoacylglycerol O-acyltransferase 2-A

Structure

DGAT1 possesses an MBOAT structural fold, creating a reaction chamber within the endoplasmic reticulum (ER) membrane to shield the acyl transfer reaction from the membrane's hydrophobic core . The reaction chamber features a tunnel-shaped entrance from the cytosolic side, which recognizes the hydrophilic Coenzyme A motif of an acyl-CoA . A slit between transmembrane regions (TM) 7 and 8 likely facilitates the entry of the acyl chain of an acyl-CoA into the chamber, where it is accommodated by a hydrophobic pocket . Additionally, the reaction chamber has a large opening to the hydrophobic core of the membrane that could allow entry of a diacylglycerol (DAG) . It is proposed that when the glycerol backbone of a DAG approaches the catalytic center His415, the two hydrophobic aliphatic acyl chains of DAG could remain partially outside of the protein and accommodated in the hydrophobic core of the membrane .

Expression and Purification

It has been observed that recombinant DGAT2 (rDGAT2) can be present in monomeric and dimeric forms on SDS-PAGE and is associated with other proteins, lipids, and membranes .

  • rDGAT2 was detected in soluble, insoluble, and membrane fractions .

  • rDGAT2 in the soluble fraction was partially purified using amylose resin, nickel-nitrilotriacetic agarose (Ni-NTA) beads, and tandem affinity chromatography .

  • Multiple proteins co-purified with rDGAT2 .

  • Size exclusion chromatography estimated the size of the rDGAT2-enriched fraction to be approximately eight times the monomer size .

  • Affinity-purified rDGAT2 fractions had a yellow tint and contained fatty acids .

  • rDGAT2 in the insoluble fraction was partially solubilized by seven detergents, with SDS being the most effective .

  • Recombinant DGAT2 was purified to near homogeneity by SDS solubilization and Ni-NTA affinity chromatography .

  • Mass spectrometry identified rDGAT2 as a component in the bands corresponding to the monomer and dimer forms as observed by SDS-PAGE .

Function

DGATs, including DGAT2, are essential acyltransferases . DGAT1 synthesizes triacylglycerides and is required for dietary fat absorption and fat storage in humans . They catalyze the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates .

Additional Information

CategoryInformation
SpeciesXenopus laevis
SourceE. coli
TagHis
Protein LengthFull Length (1-335)
FormLyophilized powder
AA SequenceMKIQFAPHNVPFERRLQTAAVLQWVFSFLALAQTCILLFFVLLFTRFWIISVVYGVWWFLDWDTPSKGGRRGEWLRRHVIWTYMKDYFPITLVKTADLDPQQNYVVGSHPHGVLVAGAFTNFCTEATGFHRLFPGITPYLLMLPLWFRAPFFRDYIMSGGLIPSDKDSASYLLKNKAGGN AVVIAVGGAPESLDARPGAFTLLIKNRKGFVRLAILHGASLVPVFSFGENELFDQVDNPRGSWLRKIQEKLQKMMGVALPLFHARGVFQYSFGLIPYRKPIATIVGKPIRVEENPNPSSEEVDKLHKIYMEELSKLFEEHKTKYNVPADKHLTFV
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
Gene Namemogat2-a
UniProt IDQ2KHS5

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
dgat2; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
dgat2
Target Protein Sequence
MKTIIAAYSGVLRGTGSSLLSAVHDLPSIPWLSKSSVVRHLQIISVLQWVLSFLILGVAC TAVLVYIFCTDLWLIAALYFTWMVLDWNTPYKGGRRSSWVRNWAVWRYFRDYFPVKLVKT HNLLPSRNYIFGYHPHGIMCLGAFCNFGTEATGVSKKFPGIKCHLATLAGNFRMPVLREY LMSGGICPVNRDTINYILSKNGTGNAVVIAVGGAAESLNCRPGKNTVTLLHRKGFVKVAL QHGADLVPIYSFGENETYKQVVFEEGSWGRWIQQKFQKYVGFAPCLFHGCSFFSSNSWGL VPYANPITTVVGEPITVPKIEQPTQKDVELYHSMYLSSLHRLFDKYKTKLGLPDSETLEF I
Uniprot No.

Target Background

Function
Recombinant Xenopus laevis Diacylglycerol O-acyltransferase 2 (dgat2) is an essential acyltransferase catalyzing the terminal, committed step in triacylglycerol synthesis. It utilizes diacylglycerol and fatty acyl CoA as substrates. This enzyme is crucial for intracellular triglyceride synthesis and storage, and likely plays a central role in cytosolic lipid accumulation.
Database Links

KEGG: xla:398800

UniGene: Xl.25952

Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.

Q&A

What is the molecular identity and function of Xenopus laevis DGAT2?

Xenopus laevis Diacylglycerol O-acyltransferase 2 (DGAT2) is an enzyme (EC 2.3.1.20) that catalyzes the final and rate-limiting step of triacylglycerol biosynthesis in eukaryotic organisms. Specifically, DGAT2 esterifies sn-1,2-diacylglycerol with a long-chain fatty acyl-CoA to form triacylglycerol . The gene encoding this protein in Xenopus laevis is designated as dgat2 (UniProt ID: Q6PAZ3), and alternative names include Diglyceride acyltransferase 2 .

The full-length protein consists of 361 amino acids with a molecular structure that includes transmembrane domains essential for its functional integration into cellular membranes. Unlike DGAT1, which belongs to a different gene family, DGAT2 is part of a distinct subfamily that includes MOGAT1, MOGAT2, MOGAT3, AWAT1, and AWAT2 .

What are the key structural features of Xenopus laevis DGAT2?

Xenopus laevis DGAT2 exhibits several important structural features that influence its function and cellular localization:

  • Transmembrane domains: The protein contains transmembrane regions, likely including two closely situated transmembrane helices near the N-terminus, similar to those identified in other DGAT2 orthologs .

  • Quaternary structure: DGAT2 has been observed in both monomeric and dimeric forms, as detected by SDS-PAGE. Size exclusion chromatography studies of related DGAT2 proteins estimate that DGAT2-enriched fractions can be approximately eight times the monomer size, suggesting complex formation with other proteins or higher-order oligomerization .

  • Membrane association: The protein is integrated into cellular membranes, consistent with its role in lipid metabolism. This membrane association is critical for accessing its lipid substrates.

  • Catalytic domain: The protein contains conserved regions essential for its enzymatic activity, including the catalytic site that coordinates the esterification reaction.

What are optimal expression systems for producing functional recombinant Xenopus laevis DGAT2?

The selection of an appropriate expression system is crucial for obtaining functional recombinant DGAT2. Based on studies with other DGAT2 proteins, the following systems have shown varying degrees of success:

Bacterial expression systems (E. coli):

Yeast expression systems (S. cerevisiae):

  • More successful for expressing functional DGAT2

  • DGAT2 expressed in yeast shows TAG synthesis activity, unlike E. coli-expressed versions

  • The H1246 yeast strain (incapable of producing TAG) has been particularly useful for functional complementation studies

  • Provides a more appropriate eukaryotic environment for proper folding and post-translational modifications

For Xenopus laevis DGAT2 specifically, a yeast expression system would likely be preferable if functional activity is required, while bacterial systems might be sufficient for structural studies or antibody production.

What purification strategies yield high-quality recombinant Xenopus laevis DGAT2?

Effective purification of recombinant DGAT2 requires strategies that address its membrane-associated nature and complex interactions. Based on studies with other DGAT2 proteins, the following approaches are recommended:

For soluble fraction purification:

  • Affinity chromatography using:

    • Amylose resin for MBP-tagged constructs

    • Nickel-nitrilotriacetic agarose (Ni-NTA) beads for His-tagged constructs

    • Tandem affinity chromatography for dual-tagged constructs

  • Size exclusion chromatography for further purification, though it's important to note that DGAT2-enriched fractions may elute at sizes approximately eight times larger than the monomer due to oligomerization or complex formation .

For insoluble fraction recovery:

  • Solubilization with appropriate detergents (SDS has been reported as particularly effective)

  • Followed by Ni-NTA affinity chromatography, which can achieve near-homogeneity

Storage recommendations:

  • Store purified protein in Tris-based buffer with 50% glycerol at -20°C

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The yellow tint observed in affinity-purified DGAT2 fractions, along with the presence of fatty acids , suggests the importance of lipid components for protein stability and should be considered during purification design.

How can researchers address the challenges of DGAT2 solubility and stability?

DGAT2's transmembrane nature presents significant challenges for maintaining solubility and stability during expression and purification. Effective strategies include:

Expression modifications:

  • Lowering induction temperature (16-20°C) to slow synthesis and improve folding

  • Reducing inducer concentration to prevent aggregation

  • Co-expression with chaperones to assist proper folding

Solubility enhancement:

  • Fusion with solubility-enhancing tags (MBP has been successfully used with DGAT2)

  • Buffer optimization with glycerol (50% has been effective in storage buffers)

  • Addition of appropriate detergents or lipids to mimic the native membrane environment

Stability considerations:

  • Include protease inhibitors during extraction and purification

  • Determine optimal pH and ionic strength conditions experimentally

  • Consider the addition of reducing agents if cysteine residues are present

  • If activity is critical, purification in the presence of substrate analogs or product molecules may help maintain the active conformation

The observation that yeast-expressed DGAT2 retains activity while E. coli-expressed protein does not suggests that post-translational modifications or specific folding environments may be critical for stability and function.

What methods are most effective for assessing the enzymatic activity of recombinant Xenopus laevis DGAT2?

Several complementary approaches can be employed to assess DGAT2 enzymatic activity:

Radioactive assays:

  • Using [14C]di-6:0-DAG (di-caproyl-DAG) as an acyl-acceptor substrate

  • Various acyl-CoA donors can be tested, including 18:3-CoA and 22:1-CoA

  • Reaction products are typically separated by thin-layer chromatography and quantified by scintillation counting

Non-radioactive assays:

  • Colorimetric assays measuring CoA release

  • Mass spectrometry-based methods for direct product detection

  • Fluorescently labeled substrate analogs for continuous monitoring

Functional complementation in vivo:

  • Expression in yeast strains incapable of producing TAG (e.g., H1246)

  • Analysis of restored lipid production using techniques like thin-layer chromatography or mass spectrometry

  • Can provide physiologically relevant information about enzyme function

This table summarizes key parameters for DGAT2 activity assays:

ParameterRecommended ConditionsNotes
pH7.0-7.5Optimal pH may vary between species
Temperature25-37°C30°C is commonly used for yeast-expressed enzymes
Substratesdi-6:0-DAG (50-100 μM), acyl-CoA (10-50 μM)Substrate concentrations should be optimized
BufferTris or phosphate with 100-150 mM NaClMay require detergents or phospholipids
Incubation time30 minutesShould verify linearity of reaction
Protein amount40 μg microsomal proteinFor microsomal preparations

How does substrate specificity of Xenopus laevis DGAT2 compare to other species?

While specific data on Xenopus laevis DGAT2 substrate preferences is limited in the provided search results, studies on DGAT2 enzymes from other species provide valuable insights into patterns of substrate specificity:

Acyl-CoA preferences:

  • Studies with Brassica napus DGAT2 enzymes revealed distinct acyl-CoA preferences despite high sequence similarity (98% within groups)

  • Some B. napus DGAT2 forms showed high specificity toward 18:3-CoA, while others accepted both 18:3-CoA and 22:1-CoA

  • This suggests that small sequence differences can significantly impact substrate recognition

Determinants of specificity:

  • The region containing two predicted transmembrane helices appears to play a critical role in determining acyl-CoA specificity

  • Swapping these regions between enzymes with different specificities altered their substrate preferences

  • This transmembrane region may be conserved across species and could serve similar functions in Xenopus laevis DGAT2

For Xenopus laevis DGAT2 specifically, experimental determination of substrate preferences would be necessary, testing various acyl-CoA donors and diacylglycerol acceptors. Given the evolutionary distance between amphibians and plants, differences in substrate specificity would be expected, though the structural determinants of specificity might be conserved.

What factors affect the catalytic activity of recombinant DGAT2?

Multiple factors can influence the catalytic activity of recombinant DGAT2:

Structural integrity:

  • Proper folding and membrane insertion are critical for activity

  • Post-translational modifications may be required, explaining why E. coli-expressed DGAT2 typically lacks activity while yeast-expressed enzyme is functional

Quaternary structure:

  • DGAT2 can exist in monomeric and dimeric forms, as detected by SDS-PAGE

  • The enzyme may function within larger complexes, as size exclusion chromatography suggests DGAT2-enriched fractions are approximately eight times the monomer size

Lipid environment:

  • The membrane environment likely plays a crucial role in orienting the enzyme and substrates

  • Affinity-purified DGAT2 fractions have been observed to have a yellow tint and contain fatty acids , suggesting lipid association is important

Mutations and sequence variations:

  • Mutations in the catalytic site can affect enzyme activity

  • The D222V mutation has been identified as a hotspot that may affect enzyme activity in cancer cells

  • The Y223H mutation has been linked to Axonal Charcot-Marie-Tooth disease , highlighting the functional sensitivity of this region

Expression system:

  • The source of recombinant DGAT2 significantly impacts activity

  • Nonradioactive assays have shown TAG synthesis activity of DGAT2 from yeast but not from E. coli

Understanding these factors is essential for designing experiments that accurately assess DGAT2 catalytic properties and for interpreting results in a physiologically relevant context.

How can chimeric enzyme approaches advance understanding of DGAT2 structure-function relationships?

Chimeric enzyme approaches, where segments from different DGAT2 proteins are exchanged, have proven valuable for elucidating structure-function relationships:

Successful application in plant DGAT2 research:

  • Studies with Brassica napus DGAT2 enzymes demonstrated that swapping regions containing two predicted transmembrane helices between enzymes with different acyl-CoA specificities resulted in altered substrate preferences

  • A chimera between Arabidopsis DGAT2 and B. napus DGAT2 showed that the specificity regulated by this region is transferable across species

Potential applications for Xenopus laevis DGAT2:

  • Mapping functional domains:

    • Creating chimeras between Xenopus DGAT2 and well-characterized DGAT2 proteins from other species

    • Systematically replacing segments to identify regions responsible for substrate specificity, membrane association, and catalytic activity

  • Investigating evolutionary conservation:

    • Chimeras between DGAT2 proteins from evolutionarily distant organisms can reveal conserved functional elements

    • This approach can distinguish between species-specific adaptations and core enzyme functions

  • Engineering modified enzymes:

    • Designing chimeras with enhanced stability, solubility, or altered substrate specificity

    • Potentially creating DGAT2 variants optimized for biotechnological applications

The observation that substrate specificity determinants can be transferred between species suggests that chimeric approaches with Xenopus laevis DGAT2 could yield valuable insights about the structural basis of DGAT2 function across taxonomic boundaries.

What insights can molecular dynamics simulations provide about DGAT2 membrane integration and function?

Molecular dynamics (MD) simulations can provide detailed atomic-level insights into DGAT2 structure and function that are difficult to obtain experimentally:

Membrane integration studies:

  • Simulations can model how DGAT2's transmembrane domains interact with lipid bilayers

  • Predict the orientation and depth of membrane insertion

  • Identify lipid-protein interactions that stabilize the membrane-integrated state

Substrate binding and catalysis:

  • Model how substrates (diacylglycerol and acyl-CoA) interact with the active site

  • Identify residues involved in substrate recognition and positioning

  • Simulate the reaction coordinate to understand the catalytic mechanism

Conformational dynamics:

  • Reveal potential conformational changes during catalysis

  • Identify flexible regions and rigid domains

  • Model how mutations might alter protein dynamics and function

Oligomerization and protein-protein interactions:

  • Simulate potential dimer or oligomer interfaces

  • Predict how oligomerization might affect function

  • Model interactions with other proteins in the lipid synthesis pathway

For Xenopus laevis DGAT2 specifically, modeling could begin with homology models based on related proteins, then refined through simulations in membrane environments. The transmembrane regions that appear to determine substrate specificity would be particularly important targets for detailed simulation studies.

How does DGAT2 contribute to evolutionary adaptation in lipid metabolism across species?

DGAT2 plays a central role in triacylglycerol synthesis across eukaryotes, making it an interesting subject for evolutionary studies:

Evolutionary conservation and divergence:

  • DGAT2 is found across eukaryotes, including plants, animals, and fungi, indicating its ancient evolutionary origin

  • At least 74 DGAT2 sequences from 61 organisms have been identified , demonstrating its wide distribution

  • DGAT2 appears to be more conserved than DGAT1 across species , suggesting stronger functional constraints

Structural conservation:

  • Analysis of plant DGAT2 enzymes revealed that 75 of 77 sequences contained two closely situated transmembrane helices near the N-terminus

  • This structural feature likely has fundamental importance for DGAT2 function across diverse organisms

Functional adaptation:

  • Despite sequence similarities, DGAT2 enzymes can show different substrate specificities

  • This suggests that small sequence changes have allowed functional adaptation to different lipid environments across species

  • The observation that Brassica napus DGAT2 enzymes with 98% sequence identity can have distinct acyl-CoA preferences demonstrates the fine-tuning potential of DGAT2 evolution

Xenopus laevis as an evolutionary model:

  • As an amphibian, Xenopus represents a distinct evolutionary lineage from the more commonly studied mammals and plants

  • Comparative studies between Xenopus DGAT2 and other species could reveal clade-specific adaptations in lipid metabolism

  • The position of amphibians in vertebrate evolution makes Xenopus DGAT2 valuable for understanding the ancestral state of vertebrate DGAT2 function

What role might DGAT2 play in lipid-related disorders and as a potential therapeutic target?

DGAT2's central role in triacylglycerol synthesis makes it relevant to various lipid-related disorders and a potential therapeutic target:

Disease associations:

  • Mutations in DGAT2 have been linked to specific conditions, including:

    • The Y223H mutation associated with Axonal Charcot-Marie-Tooth disease, a neurological disorder

    • A D222V mutation hotspot that may affect enzyme activity in cancer cells

Cancer connections:

  • Analysis of the Catalogue of Somatic Mutations in Cancer (COSMIC) identified 398 DGAT2 mutations detected in 21 different cancers

  • The highest frequency of missense mutations was observed in skin, lung, large intestine, and endometrium tissues

  • Interestingly, the Y223H mutation linked to Charcot-Marie-Tooth disease has not been detected in cancers, suggesting it is inhibitory to cancer progression

Therapeutic potential:

  • DGAT2 inhibitors have been explored for treating conditions characterized by excessive triglyceride accumulation, including:

    • Non-alcoholic fatty liver disease

    • Obesity

    • Hyperlipidemia

    • Type 2 diabetes

Xenopus laevis DGAT2 as a research tool:

  • Recombinant Xenopus DGAT2 could serve as a model system for:

    • Understanding the effects of disease-associated mutations

    • Screening potential inhibitors

    • Studying structure-function relationships relevant to therapeutic targeting

The detailed characterization of mutations affecting the catalytic site of DGAT2 provides valuable guidance for investigating how alterations in Xenopus DGAT2 might impact its function, potentially offering insights relevant to human disease mechanisms.

What strategies can resolve issues with recombinant DGAT2 expression and purification?

Researchers commonly encounter several challenges when working with recombinant DGAT2. The following troubleshooting strategies address these issues:

Low expression levels:

  • Optimize codon usage for the expression host

  • Test different promoters and induction conditions

  • Consider using specialized expression strains designed for membrane proteins

  • Evaluate different fusion tags and their positions (N- or C-terminal)

Protein insolubility:

  • Express at lower temperatures (16-20°C) to slow folding

  • Use solubility-enhancing fusion partners like MBP

  • Include appropriate detergents in extraction buffers

  • Consider adding lipids to stabilize the membrane domains

Purification difficulties:

  • For proteins in the insoluble fraction, test different detergents for solubilization (SDS has been reported as particularly effective)

  • For soluble fraction, optimize affinity chromatography conditions

  • Be aware that DGAT2 may co-purify with other proteins and lipids

  • Consider native versus denaturing conditions based on experimental needs

Low enzymatic activity:

  • Express in eukaryotic systems rather than bacteria

  • Ensure appropriate membrane environment is maintained during purification

  • Test different buffer conditions and additives

  • Consider that post-translational modifications may be necessary for activity

Storage instability:

  • Store in Tris-based buffer with 50% glycerol

  • Avoid repeated freeze-thaw cycles

  • Maintain working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -80°C

How can researchers address inconsistent or low enzymatic activity in DGAT2 assays?

Inconsistent or low enzymatic activity in DGAT2 assays can arise from multiple factors:

Enzyme-related factors:

  • Verify protein integrity with SDS-PAGE and Western blotting

  • Ensure proper folding and post-translational modifications by using appropriate expression systems

  • Check for degradation during storage or assay preparation

  • Remember that E. coli-expressed DGAT2 typically lacks activity, while yeast-expressed enzyme is functional

Substrate-related factors:

  • Ensure substrate quality and purity

  • Address solubility issues with diacylglycerol and acyl-CoA substrates

  • Optimize substrate concentrations (typical ranges: 50-100 μM for DAG, 10-50 μM for acyl-CoA)

  • Consider substrate presentation methods (detergent micelles, liposomes)

Assay conditions:

  • Optimize buffer composition, pH, and ionic strength

  • Test different temperatures (typically 25-37°C)

  • Optimize incubation times to ensure linearity

  • Include appropriate controls for background activity

Detection sensitivity:

  • For radioactive assays, ensure sufficient specific activity

  • For colorimetric or fluorescence-based assays, optimize signal-to-noise ratio

  • Consider more sensitive detection methods if activity is low

This experimental matrix can help systematically troubleshoot activity issues:

VariableTest ConditionsNotes
Enzyme sourceMicrosomal preparations vs. purified proteinMicrosomal preparations often retain higher activity
Expression systemYeast vs. E. coli vs. other systemsYeast systems have shown better functional expression
Buffer compositionVarious buffers, pH ranges, salt concentrationsTest pH range 6.5-8.0
SubstratesDifferent DAG and acyl-CoA speciesTest physiologically relevant and synthetic substrates
Detergents/lipidsPresence/absence of phospholipids or detergentsMay help present substrates properly
Reaction time10-60 minutesEnsure linearity within chosen timeframe

What controls are essential for validating results in DGAT2 research?

Rigorous controls are essential for ensuring the validity and reproducibility of DGAT2 research:

Expression and purification controls:

  • Empty vector controls processed in parallel

  • Western blotting with both tag-specific and DGAT2-specific antibodies

  • Size exclusion chromatography to assess oligomeric state and potential aggregation

  • Mass spectrometry verification of protein identity

Activity assay controls:

  • Heat-inactivated enzyme preparations

  • Reactions missing individual substrates

  • Time-course experiments to verify reaction linearity

  • Dose-response relationships with varying enzyme concentrations

  • Known DGAT inhibitors as negative controls

  • Comparison with commercially available enzymes where possible

Substrate specificity studies:

  • Full panel of acyl-CoA substrates with varying chain lengths and saturation

  • Multiple diacylglycerol species to assess acceptor preferences

  • Proper substrate solubilization controls

In vivo functional studies:

  • Using yeast strains incapable of producing TAG (e.g., H1246)

  • Empty vector transformants as negative controls

  • Positive controls expressing known functional DGAT2 enzymes

  • Lipid extraction controls to ensure complete recovery

Mutation analysis:

  • Wild-type protein expressed and analyzed in parallel

  • Conservative mutations as controls for structural perturbation

  • Catalytically inactive mutants as negative controls

  • Rescue experiments to confirm specificity of effects

These controls ensure that observed results are specifically attributable to DGAT2 function rather than experimental artifacts or confounding factors.

What are promising areas for advancing DGAT2 structural biology?

Despite its importance in lipid metabolism, detailed structural information about DGAT2 remains limited. Several promising approaches could advance our understanding of DGAT2 structure:

Cryo-electron microscopy (cryo-EM):

  • Particularly suitable for membrane proteins that resist crystallization

  • Could reveal the arrangement of transmembrane domains and potentially substrate binding sites

  • Might capture different conformational states relevant to the catalytic cycle

  • Recent advances in sample preparation and image processing make previously challenging membrane proteins accessible

X-ray crystallography of soluble domains:

  • While complete DGAT2 crystallization is challenging, individual domains might be amenable to crystallization

  • The catalytic domain would be particularly valuable for understanding substrate recognition and catalysis

  • Co-crystallization with substrate analogs or inhibitors could provide mechanistic insights

Integrative structural biology approaches:

  • Combining lower-resolution techniques (cryo-EM, small-angle X-ray scattering) with computational modeling

  • Using chemical cross-linking with mass spectrometry to define distance constraints

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions and interaction surfaces

Membrane mimetic systems:

  • Nanodiscs, lipid cubic phases, or amphipols to stabilize DGAT2 in a native-like environment

  • These approaches have proven successful for other challenging membrane proteins

  • Could help capture DGAT2 in a functionally relevant state

The identification of regions critical for substrate specificity, such as the transmembrane domains in plant DGAT2 , provides valuable guidance for focusing structural biology efforts on functionally important parts of the protein.

How might advanced genetic approaches enhance understanding of DGAT2 function?

Advanced genetic approaches offer powerful tools for investigating DGAT2 function at multiple levels:

CRISPR/Cas9 genome editing:

  • Precise modification of endogenous DGAT2 in Xenopus laevis

  • Introduction of specific mutations to test structure-function hypotheses

  • Creation of tagged versions for localization and interaction studies

  • Generation of conditional knockouts to study developmental roles

High-throughput mutagenesis:

  • Deep mutational scanning to comprehensively map functional effects of mutations

  • Directed evolution approaches to identify variants with enhanced activity or altered specificity

  • Saturation mutagenesis of key regions identified in substrate specificity studies

Synthetic biology approaches:

  • Designer DGAT2 variants with novel functions or substrate preferences

  • Integration of DGAT2 into synthetic metabolic pathways

  • Creation of orthogonal lipid synthesis systems for biotechnological applications

Comparative genomics:

  • Analysis of DGAT2 across diverse species to identify conserved functional elements

  • Correlation of sequence variations with differences in lipid metabolism across species

  • Investigation of co-evolving residues that might indicate functional coupling

Transcriptomics and proteomics:

  • Analysis of DGAT2 expression patterns in different tissues and developmental stages

  • Identification of co-regulated genes that might function in coordinated pathways

  • Characterization of the DGAT2 "interactome" to understand its broader functional context

These approaches could significantly advance our understanding of how DGAT2 functions within the complex landscape of lipid metabolism and potentially reveal new applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.