Recombinant Xenopus laevis DnaJ homolog subfamily B member 14 (dnajb14)

What is Xenopus laevis DnaJ homolog subfamily B member 14 (dnajb14)?

DnaJ homolog subfamily B member 14 (dnajb14) in Xenopus laevis is a member of the heat shock protein 40 (HSP40) family that functions as a molecular chaperone protein. The full-length protein consists of 371 amino acids with a conserved J-domain that is critical for stimulating the ATPase activity of Hsp70 proteins . The protein has a recommended full name of "DnaJ homolog subfamily B member 14" and the gene name is "dnajb14" with a UniProt identification number of Q7ZXQ8 . The protein structure includes several domains that facilitate protein-protein interactions and substrate binding, which are essential for its chaperone function in protein folding, translocation, and degradation pathways.

How is Recombinant Xenopus laevis dnajb14 typically produced for research purposes?

Recombinant Xenopus laevis dnajb14 is typically produced using molecular cloning techniques starting with poly-A+ mRNA isolation from Xenopus laevis oocytes . The process involves:

• Isolation and enrichment of mRNA coding for the target protein

• cDNA synthesis using reverse transcription

• Cloning of the cDNA into an expression vector such as plasmid pBR322

• Transformation of the recombinant vector into an expression host (commonly E. coli or mammalian cells)

• Induction of protein expression

• Protein purification using affinity chromatography, typically with a tag system

The tag type used for purification may vary depending on the specific research requirements and is often determined during the production process . The resulting protein is then formulated in a storage buffer containing Tris-based buffer with 50% glycerol, optimized specifically for this protein to maintain stability and function .

What are the optimal storage conditions for Recombinant Xenopus laevis dnajb14?

The optimal storage conditions for Recombinant Xenopus laevis dnajb14 are as follows:

Researchers should briefly centrifuge the vial prior to opening to bring contents to the bottom and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL if received as a lyophilized powder . Working aliquots should be prepared and stored at 4°C for routine experimental work, while stock solutions should be maintained at lower temperatures to preserve protein integrity and activity.

How does the amino acid sequence of Xenopus laevis dnajb14 compare to its orthologs in other species?

The amino acid sequence of Xenopus laevis dnajb14 shows considerable conservation with its orthologs in other species, particularly in functional domains. A detailed comparison reveals:

The Xenopus laevis dnajb14 amino acid sequence (MESNRDEAERCVRIGKAAIEAGDKEKARRFFSKAERLYPSSEARVLLDALEKNDTAGNGPQSEKMSKSTEQPKAEKDSSGDTGKGHTQDQVDGVQRIKKCKTYYEVLGVSPDAGEEDLKKAYRKLALKFHPDKNHAPGATEAFKKIGNAYAVLSNPEKRKQYDLTGSEDNVQNNHRNGGFDYHRGFEADITPEDLFNMFFGGGFPSGSVHTFSNGRTRYSHHQHHHHSGHDREEERADGGFSMFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGQTIKRVTENLQISYYVSKDFKSEYNGMLLQKLEKNIEEDYVANVRNNCWRERQQKQDLLHAAKVYRDER LRMKAESISMENCKELNRLTSLFRGG) shows the highest conservation in the J-domain region, which is critical for interaction with Hsp70 chaperones . The mouse ortholog contains 379 amino acids compared to 371 in Xenopus laevis, with the additional residues primarily located in regulatory regions .

What functional domains are present in Xenopus laevis dnajb14 and how do they contribute to its biological role?

Xenopus laevis dnajb14 contains several functional domains that are critical for its activity as a molecular chaperone:

The J-domain contains a highly conserved HPD motif that is essential for stimulating the ATPase activity of Hsp70 chaperones . The protein's structural features enable it to recognize and bind to non-native proteins, preventing their aggregation while facilitating their proper folding or degradation. The transmembrane domain suggests that dnajb14 may be involved in membrane-associated protein quality control mechanisms, potentially in the endoplasmic reticulum or other cellular compartments . This multidomain architecture allows dnajb14 to function as a co-chaperone in various cellular processes including protein folding, degradation, and transport.

What are the experimental challenges in studying Xenopus laevis dnajb14 function in developmental contexts?

Studying Xenopus laevis dnajb14 function in developmental contexts presents several experimental challenges:

• Genetic Redundancy: The presence of multiple gene copies (population polymorphism) observed for some Xenopus proteins suggests potential redundancy that may mask loss-of-function phenotypes . Researchers must account for this when designing knockout or knockdown experiments.

• Temporal Expression Patterns: Determining the precise developmental timing of dnajb14 expression requires careful staging of embryos and tissues, alongside sensitive detection methods.

• Protein-Protein Interaction Complexity: As a co-chaperone, dnajb14 likely interacts with multiple Hsp70 proteins and substrates. Capturing these interactions in a developmental context requires sophisticated proteomics approaches.

• Functional Redundancy with Other DnaJ Proteins: The DnaJ family is large with potential functional overlap between members, necessitating combinatorial approaches to determine specific roles.

• Technical Requirements for Protein Production: Producing functional recombinant protein with proper post-translational modifications may require eukaryotic expression systems rather than bacterial systems, increasing technical complexity .

Methodological approaches to address these challenges include using morpholino-based knockdown with careful controls, CRISPR/Cas9 gene editing, tissue-specific expression analysis, and co-immunoprecipitation studies paired with mass spectrometry to identify developmental stage-specific interaction partners.

What are the optimal conditions for using recombinant Xenopus laevis dnajb14 in in vitro chaperone activity assays?

The optimal conditions for using recombinant Xenopus laevis dnajb14 in in vitro chaperone activity assays should consider several parameters:

The assay should include proper controls such as heat-inactivated dnajb14, J-domain mutants (particularly HPD motif mutations), and reactions lacking ATP. For accurate measurement of chaperone activity, researchers should monitor either the refolding of denatured substrates (using enzymatic activity assays) or the prevention of aggregation (using light scattering techniques). The recombinant protein should be freshly thawed or used from working aliquots stored at 4°C for no more than one week to maintain optimal activity .

How can researchers effectively validate the specificity of antibodies against Xenopus laevis dnajb14?

Effective validation of antibodies against Xenopus laevis dnajb14 requires a multi-step approach:

• Recombinant Protein Controls:

  • Use purified recombinant Xenopus laevis dnajb14 as a positive control

  • Include related DnaJ family proteins as specificity controls

  • Perform Western blots to confirm antibody recognizes a band of the expected molecular weight (approximately 40-45 kDa)

• Immunoprecipitation Validation:

  • Perform immunoprecipitation from Xenopus laevis tissue or cell lysates

  • Confirm pulled-down protein by mass spectrometry

  • Validate with reverse immunoprecipitation using known interacting partners

• Knockout/Knockdown Controls:

  • Generate dnajb14 knockdown or knockout samples using morpholinos or CRISPR

  • Confirm reduction or absence of signal in these samples

  • Include rescue experiments with recombinant protein to restore signal

• Cross-Reactivity Assessment:

  • Test antibody against lysates from multiple species with varying sequence homology

  • Perform peptide competition assays with the immunizing peptide

  • Evaluate cross-reactivity with other DnaJ family members

• Immunohistochemistry Validation:

  • Compare staining patterns with mRNA expression data

  • Perform double-labeling with antibodies to known interacting partners

  • Include appropriate negative controls (secondary antibody only, pre-immune serum)

Researchers should document all validation steps and include appropriate controls in publications to ensure reproducibility and reliability of results using these antibodies.

What experimental approaches can be used to study the role of dnajb14 in Xenopus laevis embryonic development?

Several experimental approaches can be employed to study the role of dnajb14 in Xenopus laevis embryonic development:

• Temporal and Spatial Expression Analysis:

  • RT-qPCR to quantify dnajb14 mRNA levels across developmental stages

  • Whole-mount in situ hybridization to determine tissue-specific expression patterns

  • Immunohistochemistry using validated antibodies to visualize protein localization

• Loss-of-Function Studies:

  • Morpholino antisense oligonucleotides for targeted dnajb14 knockdown

  • CRISPR/Cas9-mediated gene editing to generate dnajb14 mutants

  • Dominant-negative approaches using mutated J-domain constructs

• Gain-of-Function Studies:

  • mRNA microinjection of wild-type or tagged dnajb14

  • Tissue-specific overexpression using appropriate promoters

  • Rescue experiments in knockdown/knockout backgrounds

• Interaction Partner Identification:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening with embryonic cDNA libraries

  • Proximity labeling techniques (BioID, APEX) in developing embryos

• Functional Assays:

  • Protein folding stress response analysis using heat shock or chemical stressors

  • Client protein stability and localization studies

  • Subcellular fractionation to determine compartment-specific functions

How can researchers differentiate between the specific functions of dnajb14 and other DnaJ family members in Xenopus laevis?

Differentiating between the specific functions of dnajb14 and other DnaJ family members in Xenopus laevis requires a systematic approach:

• Comprehensive Family Analysis:

  • Perform phylogenetic analysis of all DnaJ family members in Xenopus laevis

  • Create a table of sequence similarities and differences focusing on functional domains

  • Analyze expression patterns across tissues and developmental stages for all family members

• Domain-Specific Functional Studies:

  • Generate chimeric proteins by swapping domains between dnajb14 and other family members

  • Create point mutations in conserved residues specific to dnajb14

  • Evaluate functional consequences using in vitro and in vivo assays

• Client Specificity Determination:

  • Perform comparative interactome analysis using immunoprecipitation-mass spectrometry

  • Conduct in vitro binding assays with potential client proteins

  • Create a matrix of client protein preferences across DnaJ family members

• Subcellular Localization Mapping:

  • Use fluorescent protein fusions to determine precise localization patterns

  • Perform co-localization studies with organelle markers

  • Compare localization signals and patterns among family members

• Selective Rescue Experiments:

  • Knock down multiple DnaJ family members simultaneously

  • Perform selective rescue with individual family members

  • Quantify rescue efficiency for different phenotypes to determine functional specialization

These approaches should be combined with statistical analysis to determine significant functional differences between dnajb14 and other family members, allowing researchers to build a comprehensive model of functional specialization within this important chaperone family.

What bioinformatic approaches are most effective for analyzing evolutionary conservation of dnajb14 across species?

Effective bioinformatic approaches for analyzing evolutionary conservation of dnajb14 across species include:

• Multiple Sequence Alignment (MSA):

  • Align dnajb14 sequences from diverse species using MUSCLE, CLUSTALW, or T-Coffee

  • Include representatives from mammals, birds, reptiles, amphibians, and fish

  • Calculate conservation scores for each amino acid position

  • Visualize conservation patterns using tools like WebLogo or Jalview

• Phylogenetic Analysis:

  • Construct phylogenetic trees using Maximum Likelihood, Bayesian, or Neighbor-Joining methods

  • Calculate branch lengths to estimate evolutionary distances

  • Perform bootstrap analysis to assess tree reliability

  • Map key functional innovations onto the phylogenetic tree

• Domain Architecture Analysis:

  • Identify conserved domains using InterPro, Pfam, or SMART

  • Compare domain organization across species

  • Assess conservation of domain boundaries and interdomain regions

  • Calculate domain-specific evolutionary rates

• Selection Pressure Analysis:

  • Calculate dN/dS ratios to identify sites under positive or purifying selection

  • Use branch-site models to detect lineage-specific selection

  • Implement codon-based tests for selective pressure

  • Map selection patterns onto protein structure

• Structural Conservation Mapping:

  • Use homology modeling to predict structures across species

  • Calculate structural conservation using root mean square deviation (RMSD)

  • Identify structurally conserved pockets that may represent functional sites

  • Perform molecular dynamics simulations to assess conservation of dynamic properties

These bioinformatic approaches should be integrated to provide a comprehensive understanding of dnajb14 evolution, with particular attention to conserved features that likely represent functionally critical elements of the protein.

How should researchers interpret differences in experimental results when using Xenopus laevis dnajb14 compared to mammalian orthologs?

When interpreting differences in experimental results between Xenopus laevis dnajb14 and mammalian orthologs, researchers should consider several factors:

• Sequence and Structural Differences:

  • Compare amino acid sequences to identify divergent regions

  • Evaluate conservation of key functional motifs like the HPD motif in the J-domain

  • Consider differences in post-translational modification sites

  • Analyze potential structural impacts using homology modeling or experimental structures

• Evolutionary Context:

  • Consider the evolutionary distance between amphibians and mammals

  • Evaluate potential adaptations to different physiological conditions (temperature ranges, developmental programs)

  • Assess gene duplication events that might have led to subfunctionalization

  • Examine synteny to confirm true orthology relationships

• Experimental System Variables:

  • Account for differences in optimal assay conditions (temperature, pH, ionic strength)

  • Consider species-specific interaction partners that might be absent in heterologous systems

  • Evaluate differences in expression levels and tissue distribution patterns

  • Assess potential differences in regulation mechanisms

• Functional Redundancy Differences:

  • Compare the repertoire of DnaJ family members between species

  • Assess potential compensatory mechanisms in each species

  • Consider differences in stress response systems between amphibians and mammals

  • Evaluate the relative importance of dnajb14 in different cellular pathways across species

• Interpreting Framework:

  • Develop a systematic approach to categorize differences as either fundamental functional divergence or experimental artifacts

  • Use quantitative metrics to assess the magnitude of functional differences

  • Consider creating chimeric proteins to pinpoint regions responsible for functional differences

  • Validate findings in multiple experimental systems when possible

This structured interpretation approach helps researchers distinguish between species-specific adaptations and conserved core functions of dnajb14, contributing to a more nuanced understanding of chaperone biology across vertebrate evolution.

How does the function of Xenopus laevis dnajb14 compare to its human ortholog, particularly in relation to disease associations?

The function of Xenopus laevis dnajb14 shares core chaperone activities with its human ortholog, but also shows important differences particularly in disease contexts:

Human DNAJB14 is specifically associated with Long QT Syndrome 1, a cardiac arrhythmia disorder , whereas disease associations for Xenopus laevis dnajb14 are not well documented. This difference may reflect either a divergence in function or simply a lack of investigation in amphibian disease models. The human ortholog contains 8 additional amino acids compared to the Xenopus protein, which may confer subtle functional differences that become relevant in disease contexts.

Researchers can leverage this comparative relationship by:

• Using Xenopus as a model system to study basic DNAJB14 functions

• Investigating whether cardiac expression and function are conserved between species

• Exploring whether Xenopus dnajb14 can rescue defects in human cells lacking DNAJB14

• Developing disease models in Xenopus by introducing human disease-associated mutations

These approaches can provide insights into both conserved functions and species-specific adaptations of this important chaperone protein.

What insights can cross-species studies of dnajb14 provide about protein quality control mechanisms in vertebrates?

Cross-species studies of dnajb14 can provide valuable insights into the evolution and conservation of protein quality control mechanisms across vertebrates:

• Conservation of Core Quality Control Machinery:

  • The high sequence similarity between Xenopus laevis dnajb14 (371 aa) and orthologs in other species (e.g., human and mouse at 379 aa) suggests conservation of fundamental protein quality control mechanisms

  • The preserved domain architecture across species indicates maintained functional organization of chaperone networks

  • Conserved interaction with Hsp70 chaperones through the J-domain underscores the fundamental importance of this co-chaperone relationship

• Species-Specific Adaptations:

  • Differences in amino acid sequences between species may reflect adaptations to different physiological conditions (e.g., temperature ranges in amphibians versus mammals)

  • Variations in expression patterns across species can provide insights into tissue-specific requirements for protein quality control

  • Species-specific post-translational modifications may reveal regulatory mechanisms adapted to different developmental programs

• Evolutionary Trajectory of Quality Control Systems:

  • Comparing dnajb14 across evolutionary distant vertebrates can reveal which aspects of protein quality control emerged early in vertebrate evolution

  • Analysis of gene duplication events can illuminate how specialized quality control mechanisms evolved

  • Studying species-specific client proteins can demonstrate how quality control systems co-evolved with their targets

• Stress Response Variation:

  • Different environmental challenges faced by various vertebrate species may have shaped the specificity and regulation of dnajb14

  • Examining how dnajb14 responds to stress in different species can reveal both conserved and divergent aspects of cellular stress responses

  • Temperature-dependent activities may be particularly informative when comparing amphibians to mammals

Cross-species approaches should include functional complementation studies (can the protein from one species replace the function in another?), comparative interactome analyses, and examination of species-specific regulatory mechanisms controlling dnajb14 expression and activity.

How do the genomic features of Xenopus laevis dnajb14 compare to those in other model organisms?

The genomic features of Xenopus laevis dnajb14 show both similarities and differences compared to other model organisms:

The allotetraploid nature of the Xenopus laevis genome likely results in multiple copies of dnajb14, similar to the pattern observed for ribosomal proteins where "two gene copies per haploid genome were found for r-proteins L1, L14, S19, and four-five for protein S1, S8 and L32" . This genomic complexity presents both challenges and opportunities for researchers:

• Research Implications:

  • Gene redundancy may provide backup mechanisms that mask loss-of-function phenotypes

  • Multiple alleles may allow for subfunctionalization or neofunctionalization

  • Population polymorphism observed in Xenopus genes suggests genetic diversity that may affect experimental reproducibility

  • Comparative genomic approaches can reveal conserved regulatory elements that control expression

• Methodological Considerations:

  • Genetic manipulation requires accounting for multiple gene copies

  • Primer design for PCR and other molecular techniques must consider potential sequence variations

  • Expression analysis needs to distinguish between different gene copies

  • Evolutionary studies must account for gene duplication events

This genomic complexity distinguishes Xenopus laevis from mammalian models and provides a unique perspective on gene evolution and regulation that complements studies in other model organisms.

What are the key research directions for Xenopus laevis dnajb14 that remain unexplored?

Several promising research directions for Xenopus laevis dnajb14 remain unexplored:

• Developmental Biology Applications:

  • Systematic characterization of dnajb14 expression patterns throughout Xenopus development

  • Investigation of potential roles in cell fate determination and organogenesis

  • Analysis of potential functions in regenerative processes unique to amphibians

  • Examination of temperature-dependent functions during development

• Molecular Mechanism Investigations:

  • Comprehensive identification of dnajb14 client proteins in Xenopus

  • Structural studies of Xenopus dnajb14 alone and in complex with Hsp70 and substrates

  • Detailed mapping of interacting domains with various partner proteins

  • Investigation of potential roles beyond classical chaperone functions

• Comparative Evolutionary Studies:

  • Analysis of functional differences between dnajb14 in Xenopus laevis and Xenopus tropicalis

  • Investigation of subfunctionalization following gene duplication events

  • Comparative analysis of dnajb14 function across vertebrate lineages

  • Evolutionary rate analysis to identify rapidly evolving regions

• Disease Modeling Applications:

  • Generation of Xenopus models incorporating human disease-associated DNAJB14 mutations

  • Investigation of potential roles in stress-related pathologies

  • Exploration of relationships between dnajb14 and amphibian-specific diseases

  • Comparative analysis with human disease mechanisms related to DNAJB14 dysfunction

• Technical Innovation Opportunities:

  • Development of Xenopus-specific tools for dnajb14 research (antibodies, reporters)

  • Creation of inducible or tissue-specific knockout/knockdown systems

  • Application of emerging techniques like spatial transcriptomics to map dnajb14 expression

  • Development of high-throughput screening approaches using Xenopus embryos to identify dnajb14 modulators

These research directions would significantly advance our understanding of both basic chaperone biology and Xenopus-specific adaptations of protein quality control systems.

What methodological advances would most benefit research on Xenopus laevis dnajb14?

Several methodological advances would significantly benefit research on Xenopus laevis dnajb14:

• Genetic Manipulation Technologies:

  • Development of more efficient CRISPR/Cas9 protocols specifically optimized for targeting multiple gene copies in Xenopus laevis

  • Creation of conditional knockout systems for temporal and tissue-specific dnajb14 inactivation

  • Establishment of knock-in methodologies for endogenous tagging of dnajb14

  • Design of allele-specific targeting strategies to manipulate individual gene copies

• Protein Analysis Techniques:

  • Development of Xenopus-specific antibodies with validated specificity for dnajb14

  • Adaptation of proximity labeling techniques (BioID, APEX) for Xenopus embryos

  • Optimization of mass spectrometry workflows for Xenopus samples

  • Establishment of native protein complex isolation protocols from different developmental stages

• Imaging Innovations:

  • Implementation of live imaging approaches to track dnajb14 dynamics in developing embryos

  • Application of super-resolution microscopy techniques to Xenopus tissues

  • Development of FRET-based sensors to monitor dnajb14-substrate interactions

  • Adaptation of tissue clearing methods for whole-embryo visualization of dnajb14 localization

• Functional Assays:

  • Creation of reporter systems to monitor dnajb14-dependent chaperone activity in vivo

  • Development of high-throughput phenotypic screening methods in Xenopus embryos

  • Establishment of organoid culture systems from Xenopus tissues for ex vivo studies

  • Design of assays to measure protein aggregation and quality control in Xenopus embryos

• Computational Approaches:

  • Development of Xenopus-specific protein-protein interaction prediction tools

  • Creation of comprehensive databases for Xenopus protein expression and interaction data

  • Implementation of machine learning approaches to predict dnajb14 client proteins

  • Establishment of standardized bioinformatic pipelines for Xenopus genomic and proteomic data

These methodological advances would address current technical limitations and enable more sophisticated investigations into the biology of dnajb14 in Xenopus laevis.

How might research on Xenopus laevis dnajb14 contribute to broader understanding of chaperone biology and disease mechanisms?

Research on Xenopus laevis dnajb14 has significant potential to contribute to broader understanding of chaperone biology and disease mechanisms:

• Evolutionary Insights into Chaperone Networks:

  • Xenopus represents an important evolutionary position between fish and mammals

  • Comparative studies can reveal which chaperone functions are ancestral versus derived

  • Analysis of gene duplication and subfunctionalization patterns can illuminate how chaperone networks evolved

  • Investigation of amphibian-specific adaptations may reveal novel chaperone functions

• Developmental Context for Protein Quality Control:

  • The well-characterized developmental stages of Xenopus provide an excellent model for studying stage-specific chaperone requirements

  • Embryonic transparency facilitates visualization of protein aggregation and quality control in vivo

  • Targeted manipulation of dnajb14 during development can reveal critical periods for chaperone function

  • The ability to perform localized manipulations in Xenopus embryos allows for tissue-specific analysis

• Temperature-Dependent Chaperone Function:

  • As ectotherms, Xenopus provides a unique opportunity to study temperature-dependence of chaperone systems

  • Investigation of how dnajb14 function adapts to different temperatures may reveal fundamental principles of chaperone mechanism

  • Comparative studies between Xenopus and mammalian dnajb14 can highlight temperature-adaptive features

  • These insights may be relevant to understanding heat shock responses and thermal stress in human disease

• Disease Modeling Applications:

  • The association of human DNAJB14 with Long QT Syndrome 1 can be investigated using Xenopus models

  • Xenopus embryos allow for rapid assessment of cardiac phenotypes relevant to arrhythmia disorders

  • The ability to perform high-throughput drug screening in Xenopus embryos facilitates discovery of chaperone modulators

  • Insights from Xenopus studies may reveal novel therapeutic approaches for chaperone-related diseases

• Technical Advantages for Mechanistic Studies:

  • The large size of Xenopus oocytes and embryos facilitates biochemical analyses

  • The external development of embryos allows for easy manipulation and observation

  • The established use of Xenopus in protein expression studies provides technical infrastructure

  • The ability to perform cell-free protein synthesis using Xenopus egg extracts offers unique opportunities for chaperone research