Recombinant Xenopus laevis DnaJ homolog subfamily C member 25 (dnajc25)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Xenopus laevis DnaJ homolog subfamily C member 25 (dnajc25) is a biologically engineered protein derived from the African clawed frog (Xenopus laevis). This protein belongs to the DnaJ/Hsp40 family, which functions as co-chaperones by regulating ATPase activity of Hsp70 chaperones during protein folding, translocation, and degradation . The recombinant form is primarily used in research applications such as ELISA, protein interaction studies, and apoptosis assays .

Role in Protein Folding and Apoptosis

  • Chaperone Activity: DNAJC25 facilitates protein folding by stimulating Hsp70 ATPase activity, aiding in the resolution of misfolded proteins .

  • Apoptosis Induction: Overexpression of DNAJC25 in hepatocellular carcinoma (HCC) cells increases apoptosis by 18.8% in Hep3B cells and 16.4% in HEK293 cells, as shown via flow cytometry .

  • Tumor Suppression: Downregulation of DNAJC25 is observed in 57.5% of HCC tissues compared to adjacent normal tissues (>2-fold decrease; P < 0.001) .

Tissue-Specific Expression

  • Highest expression in liver tissues, with trace levels in the prostate, testis, and colon .

  • Cytoplasmic localization confirmed in HeLa and SMMC-7721 cells .

Key Studies

  1. Cancer Research: DNAJC25 inhibits colony formation in HCC cell lines (74.67% reduction in Hep3B, 79.00% in SMMC-7721; P < 0.05) .

  2. ELISA Development: Recombinant Xenopus laevis DNAJC25 is commercially available for immunoassays, with optimized stability in glycerol-based buffers .

  3. Comparative Biology: Orthologs in Xenopus tropicalis (UniProt Q5HZT9) and rats (UniProt Q5BJW9) share 98% sequence homology, enabling cross-species functional studies .

Comparative Analysis with Homologs

SpeciesUniProt IDAmino Acid LengthKey Differences
Xenopus laevis (African clawed frog)Q58E03 344Cytoplasmic localization, high liver expression
Xenopus tropicalis (Western clawed frog)Q5HZT9 368Extended N-terminal region
Homo sapiens (Human)Q9H1X3 360Linked to ER membrane, implicated in HCC

Production and Quality Control

  • Expression: Optimized in HEK293 cells for post-translational modifications .

  • Purity: ≥85% verified via SDS-PAGE .

  • Endotoxin Levels: < 1.0 EU/µg .

Challenges and Future Directions

  • Functional Complexity: The dual role of DNAJC25 in protein folding and apoptosis requires further mechanistic studies .

  • Therapeutic Potential: Its tumor-suppressive properties in HCC warrant exploration in gene therapy or small-molecule activators .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
dnajc25; DnaJ homolog subfamily C member 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
dnajc25
Target Protein Sequence
MQPRWVLLVALSVLFLSGRAGALTEGLYCGRQVCYDVLGVSRDANKGDIARAYRQLARKY HPDRYRPGDQLGPDGETRESAQEKFILVATAYETLKDEETRKDYDYMLDHPEEYYRHYYH YYSRRLAPKVDVRIVILVSVCAVSIFQYYSWWSSYNEAINYLATVTKYRIQAMEIAKQQG LLNRTKEKGKNRRSKEEIKSEEEEIIRDIIKNKIDIKGGYQKPQIFDILLFQIILFPYYM FKYISWYVRWIYTFNIQGKEYGEEEKLYLIRKYMKMSQSQFDTLEEHRKNTFLEQKLWIK ENYEVYRQEQEEETKKKMASDPRWKRYRRWMKNEGPGRLTFADD
Uniprot No.

Target Background

Database Links

UniGene: Xl.3136

Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does the genetic structure of DNAJC25 differ in Xenopus laevis compared to other model organisms?

Xenopus laevis has an allotetraploid genome, which means it likely contains two homeologs of DNAJC25 - one on the "L" (long) chromosome and one on the "S" (short) chromosome . This genetic redundancy creates both challenges and opportunities for researchers. The presence of multiple alloalleles necessitates specialized approaches for functional studies, as disrupting only one homeolog may not produce observable phenotypes due to functional compensation by the remaining intact gene . This contrasts with diploid model organisms like Xenopus tropicalis or mammals, where a single gene knockout often suffices to observe loss-of-function effects. Researchers must verify the conservation of the J domain and other functional regions across both homeologs when designing experiments targeting DNAJC25 in Xenopus laevis.

What developmental stages and tissues in Xenopus laevis show significant DNAJC25 expression?

While the search results don't provide specific information about DNAJC25 expression patterns in Xenopus laevis, we can draw inferences from studies in other organisms. In human tissues, DNAJC25 shows particularly high expression in the liver compared to other tissues . For Xenopus research, investigators would typically perform RT-PCR or in situ hybridization across various developmental stages and tissues to establish expression patterns. Preliminary experiments should examine expression from early cleavage through neurulation, organogenesis, and metamorphosis to identify key developmental windows where DNAJC25 may play critical roles. Given the known involvement of molecular chaperones in embryonic development, researchers should pay particular attention to stages involving extensive protein synthesis and tissue remodeling.

How can researchers effectively target both homeologs of DNAJC25 in Xenopus laevis using CRISPR-Cas9?

To effectively target both homeologs of DNAJC25 in Xenopus laevis using CRISPR-Cas9, researchers should:

  • Align the sequences of both L and S homeologs to identify conserved regions, particularly within functional domains like the J domain .

  • Design sgRNAs targeting sequences that are identical in both homeologs to enable simultaneous mutagenesis .

  • Confirm the specificity of the sgRNA using tools like CRISPOR to minimize off-target effects.

  • Prepare a microinjection mixture containing Cas9 protein and the designed sgRNA.

  • Inject 10 nL of this mixture into the appropriate blastomere based on established fate maps .

  • Culture the F0 embryos and collect samples for genotyping to verify successful mutagenesis of both homeologs.

The efficacy of dual homeolog targeting can be assessed through DNA sequencing of the target regions from individual embryos, followed by analysis of mutation patterns and frequencies . This approach creates mosaic F0 embryos that can be directly assessed for phenotypic effects without requiring the generation of stable lines.

What are the methodological considerations for tissue-specific knockdown or overexpression of DNAJC25 in Xenopus embryos?

For tissue-specific manipulation of DNAJC25 in Xenopus laevis, researchers should consider these methodological approaches:

For knockdown:

  • Use established fate maps to identify the appropriate blastomere for injection to target specific tissues . For example, injecting specific blastomeres at the 8-cell or 16-cell stage can target presumptive neural, epidermal, or mesodermal tissues.

  • Inject sgRNA and Cas9 protein into the selected blastomere along with a lineage tracer (e.g., fluorescent dextran) to track the targeted cells .

  • Culture embryos to the desired stage and verify targeting using the lineage tracer.

  • Confirm DNAJC25 knockdown in the targeted tissues using RT-PCR, immunohistochemistry, or in situ hybridization.

For overexpression:

  • Clone the Xenopus laevis DNAJC25 coding sequence into an expression vector with a tissue-specific promoter.

  • Alternatively, use the Gal4-UAS system, where a tissue-specific promoter drives Gal4 expression, which then activates a UAS-DNAJC25 transgene.

  • Inject the expression construct into the appropriate blastomere based on fate maps.

  • Include a fluorescent reporter (either co-injected or as part of the construct) to track expression.

For both approaches, compare experimental embryos with controls injected with non-targeting sgRNA or empty expression vectors to account for injection-related effects.

How does DNAJC25 function in the context of the Xenopus heat shock response and protein quality control network?

While specific information about DNAJC25's role in Xenopus heat shock response is not provided in the search results, we can propose a research approach to investigate this question:

  • Perform heat shock experiments (e.g., 34°C for 1 hour) on Xenopus embryos at different developmental stages.

  • Measure changes in DNAJC25 mRNA and protein levels in response to heat shock using qRT-PCR and Western blotting.

  • Use co-immunoprecipitation to identify DNAJC25 interaction partners, particularly Hsp70 family members.

  • Conduct immunofluorescence to determine if DNAJC25 localization changes following heat shock.

  • Perform DNAJC25 knockdown followed by heat shock to assess whether loss of DNAJC25 sensitizes cells to heat stress.

Given that human DNAJC25 has been implicated in apoptosis regulation , researchers should also examine whether DNAJC25 in Xenopus influences cell survival under stress conditions. This could be assessed through TUNEL assays or Annexin V staining in control versus DNAJC25-depleted embryos following heat shock or other proteotoxic stresses.

What is the optimal protocol for cloning and expressing recombinant Xenopus laevis DNAJC25?

Cloning Protocol:

  • Design primers spanning the full-length coding sequence of Xenopus laevis DNAJC25, including appropriate restriction sites for subsequent cloning. Base the design on sequences from Xenbase or the Francis Crick Institute genome browser .

  • Extract total RNA from tissues with high DNAJC25 expression (potentially liver, based on human expression patterns ).

  • Synthesize cDNA using reverse transcriptase and oligo(dT) primers.

  • Amplify the DNAJC25 coding sequence using high-fidelity polymerase under conditions similar to: 95°C for 5 min, 40 cycles of 95°C for 30 sec, 64°C for 30 sec, and 72°C for appropriate extension time, followed by a final extension at 72°C for 10 min .

  • Clone the PCR product into a sequencing vector (e.g., pMD18-T) for verification .

  • Subclone the confirmed sequence into expression vectors such as pCMV-Myc, pcDNA3.1, or pEGFP-N1 for mammalian expression, or pET or pGEX vectors for bacterial expression .

Expression and Purification Protocol:

For bacterial expression:

  • Transform the expression construct into E. coli BL21(DE3).

  • Induce protein expression with IPTG (0.1-1.0 mM) at 16-25°C for 4-16 hours.

  • Harvest cells and lyse using sonication in appropriate buffer.

  • Purify using affinity chromatography (His-tag or GST-tag depending on construct).

  • Perform size exclusion chromatography for further purification.

  • Verify purity using SDS-PAGE and protein identity by Western blotting.

For mammalian expression:

  • Transfect cells with the expression construct using an appropriate transfection reagent.

  • Harvest cells 24-48 hours post-transfection.

  • Verify expression by Western blotting or fluorescence microscopy (for GFP-tagged constructs) .

How can researchers assess DNAJC25 function through in vivo assays in Xenopus embryos?

To evaluate DNAJC25 function in Xenopus embryos, researchers can employ several complementary approaches:

Loss-of-function assays:

  • CRISPR-Cas9 mutagenesis targeting conserved regions of both DNAJC25 homeologs .

  • Morpholino oligonucleotide-mediated knockdown, designing morpholinos to block translation initiation or splicing.

  • Dominant-negative approach using constructs expressing only the J domain, which may interfere with endogenous DNAJC25-Hsp70 interactions.

Gain-of-function assays:

  • mRNA overexpression by injecting in vitro synthesized DNAJC25 mRNA into early embryos.

  • DNA overexpression using tissue-specific promoters.

  • Heat shock-inducible expression systems to control timing of DNAJC25 overexpression.

Functional readouts:

  • Morphological analysis to detect developmental abnormalities.

  • TUNEL assay or Acridine Orange staining to assess changes in apoptosis rates .

  • BrdU incorporation to measure cell proliferation.

  • Protein aggregation assays using model substrates or stress-induced aggregation models.

  • Heat shock or other stress challenges to assess resistance to proteotoxic stress.

  • Colony formation assays in Xenopus tissue explants to parallel studies in cancer cell lines .

Each approach should include appropriate controls and be quantified using objective parameters such as percentage of embryos with specific phenotypes, apoptotic index, or protein aggregation levels.

What techniques are available for visualizing DNAJC25 expression and localization in Xenopus tissues?

Several techniques can be employed to visualize DNAJC25 expression and localization in Xenopus tissues:

For mRNA expression:

  • Whole-mount in situ hybridization (WISH) using antisense RNA probes specific to DNAJC25.

  • Section in situ hybridization for detailed analysis of expression in internal tissues.

  • Fluorescent in situ hybridization (FISH) for co-localization studies with other markers.

  • RT-PCR or qRT-PCR on dissected tissues to quantify expression levels .

For protein localization:

  • Whole-mount immunohistochemistry using antibodies against DNAJC25 (may require generation of Xenopus-specific antibodies).

  • Immunofluorescence on tissue sections for higher resolution analysis.

  • Expression of fluorescently tagged DNAJC25 (e.g., DNAJC25-GFP fusion) followed by live imaging or fixation and microscopy .

  • Subcellular fractionation followed by Western blotting to biochemically confirm localization patterns.

For dynamic studies:

  • Time-lapse imaging of fluorescently tagged DNAJC25 in live embryos or explants.

  • Photoactivatable or photoconvertible tags to track protein movement.

  • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility and dynamics.

Based on studies in human cells, researchers should pay particular attention to cytoplasmic localization patterns, as DNAJC25 has been reported to localize to the cytoplasm in human cell lines .

How should researchers interpret CRISPR-Cas9 mutagenesis results for DNAJC25 in F0 Xenopus embryos given mosaicism?

Interpreting CRISPR-Cas9 mutagenesis results in F0 Xenopus embryos requires careful consideration of mosaicism. Here's a systematic approach:

  • DNA extraction and sequencing:

    • Extract genomic DNA from whole embryos or targeted tissues.

    • Amplify the targeted region using PCR.

    • Either clone individual PCR products and sequence multiple clones, or perform deep sequencing directly on PCR products .

  • Quantifying editing efficiency:

    • Use software tools (e.g., TIDE, ICE, or CRISPResso) to analyze sequencing data and determine the percentage of edited alleles.

    • Construct a table showing the types and frequencies of mutations observed:

    Embryo IDWild-type (%)In-frame indels (%)Frameshift mutations (%)Major mutation types
    Embryo 1253540-4bp, +1bp
    Embryo 2302050-7bp, -3bp
    Embryo 3154540-3bp, +2bp
  • Phenotype-genotype correlation:

    • Categorize embryos based on phenotype severity.

    • Compare mutation patterns between phenotypic categories.

    • Look for correlations between frameshift mutation frequency and phenotype severity.

    • Remember that higher editing efficiency doesn't always correlate with stronger phenotypes, as protein function may be retained with certain in-frame mutations.

  • Addressing mosaicism challenges:

    • Use tissue-specific injections to reduce complexity .

    • Include lineage tracers to identify edited cells within mosaic tissues.

    • Consider that cells with severe mutations may be selected against during development.

    • Validate findings using multiple embryos and consistent phenotype-genotype correlations.

This approach provides a framework for interpreting mosaic editing results while acknowledging the inherent variability in F0 CRISPR experiments.

What controls are essential when studying DNAJC25 function in Xenopus laevis, and how should experimental variability be addressed?

Essential controls:

  • Negative controls:

    • Uninjected embryos to assess baseline developmental patterns.

    • Embryos injected with non-targeting sgRNA for CRISPR experiments .

    • Embryos injected with control morpholino for knockdown experiments.

    • Empty vector controls for overexpression studies .

  • Positive controls:

    • Well-characterized gene targets with known phenotypes to validate experimental procedures.

    • For CRISPR experiments, include a target gene known to produce visible phenotypes (e.g., tyrosinase) to confirm system functionality.

  • Specificity controls:

    • Rescue experiments using wild-type DNAJC25 mRNA co-injected with knockdown reagents.

    • Multiple targeting approaches (e.g., different sgRNAs or morpholinos) to confirm phenotype consistency.

    • Domain mutants to identify specific functional regions (e.g., J domain mutants).

Addressing experimental variability:

  • Biological replication:

    • Use embryos from multiple females and males.

    • Perform experiments across different batches.

    • Report sample sizes clearly for each experiment.

  • Quantitative assessment:

    • Develop objective scoring systems for phenotypic categories.

    • Blind analysis to prevent observer bias.

    • Use appropriate statistical tests (e.g., Chi-square for phenotypic distributions).

  • Standardization measures:

    • Control injection volumes precisely (10 nL standard) .

    • Standardize embryo culture conditions (temperature, media).

    • Process all experimental groups simultaneously.

  • Data reporting:

    • Include detailed methods for reproducibility.

    • Report both percentage and absolute numbers of embryos in each category.

    • Present representative images of all observed phenotypic classes.

    • Document embryo survival rates to assess potential toxicity.

By implementing these controls and variability management strategies, researchers can increase confidence in their findings regarding DNAJC25 function.

How can researchers distinguish between direct effects of DNAJC25 manipulation and secondary consequences in developmental studies?

Distinguishing direct effects from secondary consequences of DNAJC25 manipulation requires multiple complementary approaches:

  • Temporal analysis:

    • Monitor phenotype progression through detailed time-course studies.

    • Identify the earliest detectable changes as potential direct effects.

    • Use inducible systems (heat shock promoters or hormone-inducible constructs) to manipulate DNAJC25 expression at specific developmental stages.

    • Compare early versus late manipulation to distinguish primary from secondary effects.

  • Spatial analysis:

    • Use tissue-specific targeting by injecting specific blastomeres .

    • Compare phenotypes in directly targeted tissues versus adjacent non-targeted regions.

    • Employ tissue-specific promoters to restrict DNAJC25 manipulation to specific cell types.

    • Analyze non-autonomous effects by comparing cell behaviors at boundaries between manipulated and unmanipulated regions.

  • Molecular analysis:

    • Perform transcriptome analysis (RNA-seq) at early timepoints after DNAJC25 manipulation.

    • Identify immediate early response genes as potential direct targets.

    • Conduct proteomics to identify proteins with altered stability or abundance.

    • Use ChIP-seq or similar approaches to identify chromatin regions affected by DNAJC25 manipulation.

  • Biochemical validation:

    • Perform co-immunoprecipitation to identify direct DNAJC25 protein interaction partners.

    • Use in vitro assays to test direct effects on protein folding or Hsp70 ATPase activity.

    • Employ protein-protein interaction assays (yeast two-hybrid, proximity ligation) to confirm direct targets.

  • Rescue experiments:

    • Design structure-function rescue experiments using DNAJC25 variants with mutations in specific domains.

    • Attempt phenotypic rescue with downstream effectors to place DNAJC25 in signaling pathways.

    • Use pharmacological agents to bypass DNAJC25 in potential pathways.

By integrating these approaches, researchers can build a comprehensive picture of direct DNAJC25 functions versus secondary developmental consequences of its manipulation.

How might DNAJC25's potential tumor suppressor role in Xenopus models inform human cancer research?

The identification of DNAJC25 as a potential tumor suppressor in human hepatocellular carcinoma (HCC) opens several research avenues using Xenopus models:

  • Comparative functional analysis:

    • Generate Xenopus models with DNAJC25 knockdown in liver tissue using tissue-targeted CRISPR .

    • Compare gene expression profiles between these models and human HCC samples to identify conserved pathways.

    • Investigate whether DNAJC25 deficiency in Xenopus hepatocytes alters cell proliferation and apoptosis rates as observed in human cell lines .

  • Mechanistic studies:

    • Characterize DNAJC25 protein interactions in normal and transformed Xenopus cells using immunoprecipitation followed by mass spectrometry.

    • Investigate changes in the proteostasis network and determine if DNAJC25 loss affects protein degradation pathways.

    • Examine epigenetic modifications associated with DNAJC25 expression changes in both systems.

  • Translational applications:

    • Use Xenopus tumor explants as a screening platform for compounds that restore DNAJC25 expression or function.

    • Test whether DNAJC25 overexpression can suppress tumor formation in Xenopus models of liver cancer.

    • Develop an experimental table comparing tumor suppression effects across different intervention strategies:

    InterventionProliferation reductionApoptosis inductionTumor growth inhibitionXenopus modelHuman HCC cells
    DNAJC25 overexpression+++++++++++Not tested74-79% reduction
    J-domain mutant+++HypotheticalHypothetical
    Small molecule X+++++++HypotheticalHypothetical
  • Biomarker development:

    • Evaluate whether DNAJC25 expression patterns in Xenopus models correlate with cancer progression stages.

    • Identify secreted factors or circulating markers associated with DNAJC25 downregulation.

    • Validate these markers in human patient samples to assess clinical relevance.

These approaches could establish Xenopus as a valuable model for studying DNAJC25's tumor suppressor functions while providing insights relevant to human cancer biology and potential therapeutic strategies.

What novel experimental approaches could advance our understanding of DNAJC25 homeolog evolution and subfunctionalization in Xenopus laevis?

To investigate DNAJC25 homeolog evolution and subfunctionalization in the allotetraploid Xenopus laevis genome, researchers could employ these innovative approaches:

  • Comparative genomics and evolutionary analysis:

    • Compare DNAJC25 sequences across Xenopus species (X. laevis, X. tropicalis, X. borealis) and other amphibians.

    • Calculate selection pressures (dN/dS ratios) on different domains of L and S homeologs to identify regions under purifying or diversifying selection.

    • Reconstruct the evolutionary history of DNAJC25 gene duplication events relative to Xenopus speciation.

    • Generate phylogenetic trees of DNAJC25 across vertebrates to place Xenopus variants in evolutionary context.

  • Homeolog-specific expression and regulation:

    • Develop homeolog-specific qRT-PCR assays targeting unique 3'UTR sequences to quantify expression of each variant across tissues and developmental stages.

    • Perform ChIP-seq to compare promoter occupancy and enhancer usage between homeologs.

    • Use ATAC-seq to identify differential chromatin accessibility at regulatory regions of each homeolog.

    • Apply ribosome profiling to assess translational efficiency of each homeolog.

  • Functional differentiation:

    • Generate homeolog-specific CRISPR knockouts targeting unique sequences in each variant .

    • Compare phenotypes between L-homeolog knockouts, S-homeolog knockouts, and double knockouts.

    • Perform reciprocal rescue experiments testing whether one homeolog can compensate for the other.

    • Use domain-swapping between homeologs to identify regions responsible for functional differences.

  • Protein-level analysis:

    • Perform comparative interactome studies using BioID or proximity labeling to identify homeolog-specific protein interaction partners.

    • Analyze subcellular localization patterns of each homeolog using fluorescent tags and high-resolution microscopy.

    • Compare biochemical properties (ATP hydrolysis stimulation, substrate binding) of recombinant proteins from each homeolog.

This multi-faceted approach would provide comprehensive insights into how genome duplication and subsequent evolution have shaped DNAJC25 function in Xenopus laevis, with broader implications for understanding the consequences of genome duplication events in vertebrate evolution.

What emerging technologies could enhance the study of DNAJC25 function in protein quality control networks within Xenopus models?

Several cutting-edge technologies could significantly advance our understanding of DNAJC25's role in protein quality control networks within Xenopus models:

  • Advanced genome editing technologies:

    • Prime editing or base editing systems for precise nucleotide modifications in DNAJC25 .

    • Inducible CRISPR systems (e.g., Cas9 fused to hormone-binding domains) for temporal control of DNAJC25 disruption.

    • CRISPR activation (CRISPRa) or interference (CRISPRi) for modulating DNAJC25 expression without altering the sequence.

    • Optical control of CRISPR systems for spatiotemporal manipulation in transparent Xenopus embryos.

  • Proteostasis network analysis:

    • Proximity-dependent biotin labeling (BioID, TurboID) to identify DNAJC25 substrates and interactors in vivo.

    • FRET/FLIM sensors to visualize DNAJC25-Hsp70 interactions in live Xenopus embryos.

    • Fluorescent protein aggregation reporters to assess the impact of DNAJC25 manipulation on protein folding homeostasis.

    • Thermal proteome profiling to examine global protein stability changes upon DNAJC25 manipulation.

  • Single-cell technologies:

    • Single-cell RNA-seq to capture cell-type-specific responses to DNAJC25 manipulation during development.

    • Single-cell proteomics to identify differential protein expression patterns.

    • Spatial transcriptomics to map DNAJC25 expression and downstream effects with tissue context.

    • Cell-specific translatomics to assess translational changes in defined cell populations.

  • In vivo imaging advances:

    • Light sheet microscopy for whole-embryo imaging of fluorescently tagged DNAJC25 during development.

    • Super-resolution microscopy to visualize DNAJC25 interaction with subcellular structures.

    • Optogenetic tools to manipulate DNAJC25 function with light in specific cells.

    • Intravital microscopy for long-term tracking of DNAJC25-dependent processes.

  • Computational approaches:

    • AlphaFold or RoseTTAFold predictions of Xenopus DNAJC25 structure and interaction interfaces.

    • Machine learning algorithms to identify patterns in phenotypic data from DNAJC25 manipulation.

    • Network analysis tools to place DNAJC25 within broader proteostasis pathways.

    • Molecular dynamics simulations to understand DNAJC25-substrate interactions.

Integration of these technologies would provide unprecedented insights into DNAJC25 function within the complex proteostasis landscape of developing Xenopus embryos.

Recommendations for establishing standardized protocols in Xenopus DNAJC25 research

To facilitate reproducibility and cross-laboratory comparisons in Xenopus DNAJC25 research, we recommend establishing the following standardized protocols:

  • Nomenclature standards:

    • Adopt consistent naming for homeologs (e.g., dnajc25.L and dnajc25.S) across publications.

    • Standardize mutation descriptions following HGVS guidelines.

    • Use unified identifiers when referring to specific Xenopus models.

  • Genetic manipulation protocols:

    • Establish a repository of validated sgRNA sequences targeting different regions of DNAJC25 homeologs .

    • Develop standard injection protocols with defined concentrations and volumes (10 nL) .

    • Create consensus scoring systems for phenotypic classification.

  • Expression analysis:

    • Design homeolog-specific primers for qRT-PCR that can be used across studies.

    • Establish reference housekeeping genes appropriate for different developmental stages.

    • Develop standardized in situ hybridization protocols with validated probe sequences.

  • Data sharing:

    • Contribute sequence information and expression data to Xenbase.

    • Deposit detailed protocols in repositories like protocols.io.

    • Share plasmids and CRISPR constructs through Addgene or similar repositories.

  • Validation criteria:

    • Establish minimum standards for confirming knockout efficiency.

    • Define appropriate controls for different types of experiments.

    • Develop consensus on sample sizes needed for statistical significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.