Recombinant Xenopus laevis Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 (dad1)

Shipped with Ice Packs
In Stock

Description

Overview of DAD1 Protein

DAD1 (Defender Against cell Death 1) was initially identified as a negative regulator of programmed cell death in temperature-sensitive cell lines, where its disappearance at non-permissive temperatures triggered apoptosis . The protein has since been recognized as a tightly associated subunit of oligosaccharyltransferase, essential for N-linked glycosylation in eukaryotes . This dual functionality places DAD1 at the intersection of protein quality control and cell survival pathways.

Significance in Xenopus laevis Model System

Xenopus laevis, the African clawed frog, serves as an important model organism in developmental biology and biochemical research. Its DAD1 protein shares significant sequence and functional conservation with homologs across species, making it valuable for comparative studies of fundamental cellular processes. The recombinant production of Xenopus laevis DAD1 provides researchers with a purified, well-characterized protein for structural and functional investigations.

Importance of Recombinant Production

The recombinant version of Xenopus laevis DAD1 is produced through heterologous expression systems, primarily in E. coli, allowing for high-yield, high-purity protein production . This approach offers advantages in terms of scalability, consistency, and potential for modification through protein engineering, facilitating detailed biochemical and structural studies that would be challenging with native protein isolation.

Gene and Protein Structure

The dad1 gene in Xenopus laevis encodes the DAD1 protein, which consists of 113 amino acids forming a small but functionally critical protein . The gene is highly conserved across species, reflecting the essential nature of its function in eukaryotic cells. The DAD1 protein has a molecular weight of approximately 12 kDa , consistent with its role as a subunit in larger protein complexes.

Comparison with DAD1 from Other Species

The DAD1 protein exhibits remarkable evolutionary conservation across species, from yeast to humans, indicating its fundamental importance in cellular processes. Recombinant versions are commercially available from various species including human, mouse, chicken, rat, and plant species such as Arabidopsis thaliana, Solanum lycopersicum (tomato), and Malus domestica (apple) . This conservation facilitates comparative studies and allows researchers to extrapolate findings across different model systems.

Role in Protein Glycosylation

DAD1 serves as a critical subunit of the oligosaccharyltransferase complex, which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues in nascent proteins . This N-linked glycosylation process is essential for proper protein folding, stability, and function. The glycosylation occurs co-translationally as proteins enter the endoplasmic reticulum, with the oligosaccharyltransferase complex recognizing specific sequence motifs (typically Asn-X-Ser/Thr) in the target proteins.

Function as a Subunit of Oligosaccharyltransferase

The oligosaccharyltransferase complex consists of multiple subunits, with DAD1 being one of the tightly associated components . This complex facilitates the transfer of oligosaccharides from dolichyl-diphosphooligosaccharide donors to protein acceptors, a critical step in the N-glycosylation pathway. Temperature-sensitive mutations in the ost2 gene (which corresponds to DAD1) lead to defects in N-linked glycosylation of proteins in vivo and reduced glycosylation of synthetic peptide substrates in vitro , confirming DAD1's essential role in this process.

Anti-apoptotic Properties

Beyond its role in glycosylation, DAD1 was initially identified as a negative regulator of programmed cell death . Its name, "Defender Against cell Death 1," reflects this anti-apoptotic function. Studies have shown that the loss of DAD1 protein in temperature-sensitive cell lines triggers apoptosis, suggesting that DAD1 may serve as a link between protein glycosylation and cell survival pathways. The protein has been shown to interact with MCL1, a member of the Bcl-2 family of anti-apoptotic proteins , further supporting its role in regulating cell death.

Cellular Localization

DAD1 is primarily localized to the endoplasmic reticulum membrane, consistent with its role in the oligosaccharyltransferase complex and N-linked glycosylation. This localization is critical for its function, as N-linked glycosylation occurs as proteins enter the endoplasmic reticulum during translation. The protein's transmembrane domains anchor it in the membrane, positioning it appropriately for interaction with other components of the glycosylation machinery.

Expression Systems

Recombinant Xenopus laevis DAD1 is primarily produced using E. coli expression systems , which offer advantages in terms of scalability, cost-effectiveness, and high yield. Alternative expression systems, including yeast, baculovirus, mammalian cell lines, and cell-free expression systems are also utilized depending on specific research requirements . Each system offers distinct advantages in terms of post-translational modifications, protein folding, and yield.

Protein Tags and Modifications

Commercially available recombinant Xenopus laevis DAD1 is often produced with affinity tags, particularly histidine (His) tags, to facilitate purification . These tags can be positioned at either the N- or C-terminus of the protein, depending on the specific construct design. The full-length recombinant protein typically includes all 113 amino acids of the native sequence, though partial constructs are also available for specialized applications .

Purification Methods

The purification of recombinant DAD1 typically involves affinity chromatography, leveraging the incorporated His-tag for selective binding to metal-chelating resins. This approach allows for high-purity protein isolation, typically achieving greater than 90% purity as determined by SDS-PAGE analysis . Additional purification steps, including size-exclusion chromatography and ion-exchange chromatography, may be employed to further enhance purity for specialized applications.

Quality Control Parameters

Commercial recombinant DAD1 proteins undergo rigorous quality control testing to ensure identity, purity, and biological activity. Key quality control parameters include:

  • Purity assessment via SDS-PAGE (typically >85-90%)

  • Protein concentration determination

  • Endotoxin testing for proteins produced in bacterial systems

  • Functional assays, where applicable

  • Stability testing under various storage conditions

Reconstitution Procedures

Proper reconstitution is critical for maintaining protein activity. The recommended procedure involves:

  1. Brief centrifugation of the vial prior to opening

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (5-50% final concentration) for long-term storage

  4. Aliquoting to minimize freeze-thaw cycles

Stability Considerations

Several factors affect the stability of recombinant DAD1, including temperature fluctuations, pH changes, exposure to proteases, oxidation, and mechanical stress. Proper handling and storage practices, including the use of appropriate buffers, protease inhibitors (where necessary), and controlled temperature conditions, can significantly extend the shelf life and maintain the functionality of the recombinant protein.

Table 1: Technical Specifications of Recombinant Xenopus laevis DAD1 Protein

ParameterSpecificationReference
SpeciesXenopus laevis
Expression SystemE. coli
TagHis
Protein LengthFull Length (1-113 amino acids)
Physical FormLyophilized powder
Amino Acid SequenceMSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water, 0.1-1.0 mg/mL
ApplicationsSDS-PAGE, functional assays
Gene Namedad1
SynonymsDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1; Oligosaccharyl transferase subunit dad1; Defender against cell death 1; DAD-1
UniProt IDP46967

Functional Assays

The purified recombinant protein can be used in various functional assays to investigate:

  • Protein-protein interactions, particularly with other components of the oligosaccharyltransferase complex and apoptosis-related proteins like MCL1

  • Glycosylation activity in reconstituted systems

  • Structure-function relationships through site-directed mutagenesis

  • Inhibitor screening for potential therapeutic applications

Comparative Studies

The availability of recombinant DAD1 from various species, including Xenopus laevis, facilitates comparative studies to investigate evolutionary conservation and species-specific adaptations. These studies can provide insights into the fundamental mechanisms of N-linked glycosylation and apoptosis regulation across different organisms.

Table 2: Comparative Analysis of DAD1 Protein Across Species

SpeciesProtein LengthKey FeaturesAvailable as Recombinant ProteinReference
Xenopus laevis113 aaFull-length recombinant protein available with His-tagYes
Human113 aa~12 kDa; Interacts with MCL1Yes
MouseNot specifiedGene synonym: AI323713Yes
RatNot specifiedDefender against cell death 1Yes
ChickenNot specifiedConservation across vertebratesYes
Arabidopsis thalianaNot specifiedPlant homolog; Gene synonyms: ATDAD1, DEFENDER AGAINST APOPTOTIC DEATH 1Yes
Solanum lycopersicum (Tomato)Not specifiedPlant homologYes
Malus domestica (Apple)Not specifiedPlant homologYes
Picea mariana (Black spruce)Not specifiedConservation in gymnospermsYes
Araneus ventricosus (Spider)Not specifiedConservation in invertebratesYes

Therapeutic Potential

Understanding the molecular details of DAD1's function in glycosylation and apoptosis regulation may have implications for therapeutic development. Potential applications include:

  • Targeting protein glycosylation pathways in disease states

  • Modulating apoptosis in cancer and degenerative disorders

  • Developing biomarkers for diseases associated with glycosylation defects

  • Engineering glycoproteins for improved therapeutic properties

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate any special format requirements. Please specify your desired format when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
dad1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1; Oligosaccharyl transferase subunit dad1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
Target Protein Sequence
MSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGF ISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG
Uniprot No.

Target Background

Function
Dad1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process marks the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex at the channel-forming translocon complex, which mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for achieving maximal enzyme activity.
Database Links

KEGG: xla:397721

UniGene: Xl.43587

Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is DAD1 and what are its primary functions in Xenopus laevis?

DAD1 (defender against apoptotic cell death) serves dual critical roles in Xenopus laevis. First, it functions as an essential subunit of the oligosaccharyltransferase (OST) enzyme complex responsible for initiating N-linked glycosylation of proteins. Second, it acts as a negative regulator of programmed cell death. The protein is encoded by the dad1 gene located adjacent to the TCR α and δ genes on chromosome 14 in mice, with similar genomic organization conserved across species . The DAD1 protein in Xenopus laevis consists of 113 amino acids and has a molecular weight of approximately 12.5 kDa, making it the smallest subunit of the OST complex .

In its role as an OST component, DAD1 is essential for proper N-linked glycosylation, a highly conserved protein modification reaction occurring in all eukaryotic organisms. This process takes place on the luminal face of the endoplasmic reticulum, where the OST complex catalyzes the transfer of preassembled high mannose oligosaccharides onto specific asparagine residues of nascent polypeptides . Loss of DAD1 function leads to severe defects in glycosylation that ultimately contribute to cell death via apoptosis .

How is DAD1 structurally integrated within the OST complex?

The oligosaccharyltransferase complex in Xenopus laevis, as in other mammals, consists of multiple subunits including ribophorin I, ribophorin II, OST48, and DAD1. Biochemical analyses have demonstrated that DAD1 is tightly associated with this complex both in intact membranes and in the purified enzyme . Sedimentation velocity analyses of detergent-solubilized cells show that DAD1 cosediments precisely with OST activity and with the other OST subunits .

Cross-linking studies using dithio bis(succinimidylpropionate) have revealed that DAD1 can be directly cross-linked to OST48 in intact microsomes. Additionally, cross-linked heterodimers (ribophorin II–OST48), heterotrimers (DAD1–ribophorin II–OST48), and heterotetramers (DAD1–ribophorin I–ribophorin II–OST48) have been detected, confirming the intimate association of DAD1 with other OST components . Radioiodination experiments of the purified OST indicate that DAD1 is present in roughly equimolar amounts relative to the other subunits, underscoring its importance in the complex structure .

What advantages does Xenopus laevis offer as a model for DAD1 research?

Xenopus laevis offers several distinct advantages as a model organism for studying DAD1 function:

  • Evolutionary relevance: X. laevis shows evolutionary closeness to higher vertebrates in terms of physiology, gene expression, and organ development, making findings potentially translatable to human systems .

  • Experimental accessibility: This species produces large numbers of eggs (approximately one hundred) that are easily fertilized both in vitro and in vivo, enabling researchers to generate numerous embryos in a short time period throughout all seasons .

  • Developmental studies: The well-characterized embryonic stages of X. laevis allow for precise temporal studies of DAD1 expression and function during development .

  • Ethical considerations: Using X. laevis embryos and early developmental stages may present fewer ethical constraints compared to mammalian models .

  • Live imaging compatibility: Xenopus organs and cell cultures are ideal for long periods of live imaging because they are easily obtained and maintained without requiring special culture conditions .

What are recommended protocols for working with recombinant Xenopus laevis DAD1?

When working with recombinant Xenopus laevis DAD1 protein, researchers should follow these methodological guidelines:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal) for long-term storage.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles .

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt.

  • After reconstitution, store working aliquots at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C/-80°C in the presence of glycerol .

Buffer Composition:
The recommended storage buffer is Tris/PBS-based with 6% Trehalose at pH 8.0, which helps maintain protein stability .

How can DAD1 functionality be assessed in experimental systems?

Researchers can assess DAD1 functionality through several complementary approaches:

1. Glycosylation Assays:
Since DAD1 is a critical component of the OST complex, its functionality can be assessed by measuring N-linked glycosylation efficiency. After experimental manipulation of DAD1 (knockdown, overexpression, or mutation), researchers can:

  • Monitor glycosylation status of known OST substrates using gel mobility shift assays

  • Employ glycosidase treatments followed by Western blotting to detect alterations in glycosylation patterns

2. Protein Interaction Studies:

  • Co-immunoprecipitation to detect DAD1 interactions with other OST subunits

  • Cross-linking experiments using reagents like dithio bis(succinimidylpropionate) followed by immunoblotting

3. Apoptosis Assessment:

  • Flow cytometry with annexin V/propidium iodide staining

  • TUNEL assays to detect DNA fragmentation

  • Caspase activity assays to measure downstream apoptotic signaling

4. Temperature-shift Experiments:
Based on studies with the temperature-sensitive BHK21-derived tsBN7 cell line, researchers can design temperature-shift protocols to study DAD1 function in Xenopus systems .

How does DAD1 inhibit apoptotic pathways?

DAD1's anti-apoptotic activity appears to be linked to both its role in protein glycosylation and potentially through direct signaling mechanisms. The precise mechanisms through which DAD1 prevents apoptosis include:

  • Maintenance of protein glycosylation: Loss of DAD1 leads to underglycosylation of proteins, which can trigger the unfolded protein response (UPR) and endoplasmic reticulum stress, ultimately leading to apoptosis. By ensuring proper glycosylation as part of the OST complex, DAD1 prevents this stress-induced cell death pathway .

  • Stabilization of the OST complex: Studies with temperature-sensitive cell lines have shown that degradation of DAD1 affects the stability of other OST components (OST48 and ribophorins) and results in functional inactivation of the entire OST complex. This destabilization appears to precede apoptotic cell death .

  • T-cell specific effects: In immune system contexts, DAD1 levels are modulated during T cell development, reaching maximal expression in mature thymocytes. Transgenic mice overexpressing DAD1 show hyperproliferation of peripheral T cells in response to stimuli, suggesting a role in T cell activation and survival beyond glycosylation functions .

What experimental evidence connects DAD1 deficiency to apoptosis?

The connection between DAD1 deficiency and apoptosis is supported by several key experimental findings:

  • In the baby hamster kidney-derived tsBN7 cell line, a point mutation in the DAD1 gene causes cells to undergo apoptosis at non-permissive temperatures. At these temperatures, the mutant DAD1 protein becomes undetectable within 6 hours .

  • Following the degradation of DAD1 at non-permissive temperatures:

    • Steady-state levels of ribophorins decrease by approximately 50%

    • OST48 becomes barely detectable

    • N-glycosylation of ribophorins is severely affected within 6 hours

    • After 12 hours, ribophorins are synthesized only in non-glycosylated forms

    • Secretory glycoproteins exhibit underglycosylation

  • These glycosylation defects and protein destabilization events precede cell death through apoptotic mechanisms, indicating a causal relationship between DAD1 loss, glycosylation defects, and apoptotic induction .

How can CRISPR-Cas9 technology be applied to study DAD1 function?

CRISPR-Cas9 technology offers powerful approaches for investigating DAD1 function in Xenopus laevis through several strategies:

1. Gene Editing Applications:

  • Creation of conditional knockouts to study tissue-specific DAD1 functions

  • Introduction of point mutations to recapitulate temperature-sensitive phenotypes seen in hamster tsBN7 cells

  • Generation of tagged versions of DAD1 for visualization and protein interaction studies

2. Experimental Design Considerations:

  • Target design must account for the tetraploid nature of Xenopus laevis, which may require targeting multiple alleles

  • Delivery methods should be optimized for embryonic stages when studying developmental roles

  • Phenotypic analysis should include both glycosylation and apoptosis assessments

3. Rescue Experiments:

  • Co-injection of wild-type DAD1 mRNA with CRISPR components to validate specificity

  • Design of rescue constructs with mutations in proposed functional domains to perform structure-function analyses

What are current research frontiers in understanding DAD1's dual functionality?

Current research frontiers exploring DAD1's dual roles in glycosylation and apoptosis regulation include:

  • Domain-specific functional analysis: Identifying which regions of the 113 amino acid DAD1 protein are critical for OST complex integration versus apoptosis regulation. This could help determine whether these functions can be separated .

  • Temporal regulation during development: Given that DAD1 expression levels change during T cell development, research is examining how DAD1 expression is regulated during different developmental stages and in different tissues of Xenopus laevis .

  • Interaction with apoptotic machinery: Beyond its role in glycosylation, investigations are exploring potential direct interactions between DAD1 and components of apoptotic pathways, similar to how other apoptosis regulators like Bcl-2 function .

  • Stress response pathways: Research is examining how DAD1 integrates into cellular stress response pathways, particularly in contexts where protein folding and quality control are compromised .

How does DAD1 function in Xenopus laevis compare to other model organisms?

DAD1 function shows remarkable conservation across species while exhibiting some model-specific differences:

Model OrganismDAD1 SizeKey Functional AspectsExperimental Advantages
Xenopus laevis113 aa, ~12.5 kDaDual role in OST complex and apoptosis inhibitionExternal development, large embryo numbers, easy manipulation
Yeast (OST2p)16 kDa40% identical to mammalian DAD1, essential for viabilityGenetic tractability, simple OST complex
Mammalian systems12.5 kDaSimilar dual functionality, temperature-sensitive mutants availableCloser to human systems, established cell lines
C. elegansSimilar to mammalianOverexpression studies conductedTransparent body, programmed cell death well-characterized

The conservation of DAD1 function across these diverse species highlights its fundamental importance in eukaryotic biology. While the protein's core functions in glycosylation and cell survival are maintained across species, context-specific regulation and interaction partners may differ .

What technical challenges exist in DAD1 research and how can they be addressed?

Several technical challenges exist in DAD1 research, with corresponding methodological solutions:

1. Protein Stability Issues:

  • Challenge: DAD1 is a small, hydrophobic membrane protein that can be difficult to maintain in stable form

  • Solution: Use of stabilizing agents like trehalose (6%) in storage buffers, maintaining reconstituted protein at appropriate pH (8.0), and avoiding repeated freeze-thaw cycles

2. Functional Assessment Complexity:

  • Challenge: Separating DAD1's glycosylation role from its anti-apoptotic function

  • Solution: Design of point mutants that affect one function but not the other, coupled with complementary assays for both glycosylation and apoptosis

3. Xenopus-Specific Considerations:

  • Challenge: The tetraploid nature of Xenopus laevis complicates genetic approaches

  • Solution: Use of Xenopus tropicalis (diploid) for certain genetic studies, or careful design of targeting strategies that account for potential redundancy

4. Developmental Context:

  • Challenge: DAD1 expression and function may vary across developmental stages

  • Solution: Stage-specific analyses using precisely timed experiments and conditional expression/knockout systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.