Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH2 (41335)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
marchf2; march2; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING-type E3 ubiquitin transferase MARCHF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
march2
Target Protein Sequence
MTTGDCCHLPGSLCDCTDSATFLKSLEESDLGRPQYVTQVTAKDGQLLSTVIKALGTQSD GPICRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPR PVTEWLKDPGPRHEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLQFNSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVLLLIPDSKTATTIHHSFLSSKLLKFA SDETTV
Uniprot No.

Target Background

Function

MARCH2 (Membrane-Associated Ring-CH-type finger 2) is a Xenopus laevis E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and then directly transfer the ubiquitin to target substrates.

Database Links

KEGG: xla:495994

UniGene: Xl.49867

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

What is Xenopus laevis E3 ubiquitin-protein ligase MARCH2?

E3 ubiquitin-protein ligase MARCH2 is a member of the membrane-associated RING-CH-type finger (MARCH) family of proteins. In Xenopus laevis (African clawed frog), MARCH2 functions as an E3 ligase that facilitates the transfer of ubiquitin to target proteins, marking them for degradation or altering their cellular functions. The protein contains an N-terminal RING-CH domain followed by transmembrane domains and is also known as Membrane-associated RING finger protein 2 or Membrane-associated RING-CH protein II (MARCH-II) . The full-length protein consists of 246 amino acid residues and has the UniProt accession number Q5PQ35 .

How does MARCH2 relate to other members of the MARCH family?

MARCH2 belongs to the MARCH family, which consists of 11 members in mammals. These proteins evolved from viral homologs found in Kaposi's sarcoma-associated herpesvirus (KSHV) and are characterized by their RING-CH domains and transmembrane segments . While MARCH8 (formerly c-MIR) was the first identified human MARCH protein, all family members possess RING-CH domains with E3 ubiquitin ligase activity .

The MARCH family plays diverse roles in cellular processes, particularly in immune regulation. For instance, MARCH1 and MARCH8 regulate MHC-II expression, with MARCH8-mediated polyubiquitination of MHC-II being regulated by CD83 . Like other family members (MARCH5-8 and MARCH10), MARCH2's stability is tightly regulated by its RING-CH finger-mediated autoubiquitination .

What are the specific cellular functions of MARCH2 in protein trafficking?

MARCH2 plays a critical role in the early secretory pathway between the endoplasmic reticulum (ER) and Golgi compartments. Research has shown that MARCH2 directs the ubiquitination and subsequent degradation of ERGIC3 (ER-Golgi intermediate compartment protein 3), an ortholog of yeast Erv46 that functions as a cargo receptor .

Through this regulatory mechanism, MARCH2 affects the trafficking of ERGIC3-binding secretory proteins. Specifically, studies have demonstrated that:

  • MARCH2 targets lysine residues at positions 6 and 8 of ERGIC3 for ubiquitination

  • MARCH2 depletion increases endogenous ERGIC3 levels

  • MARCH2 expression reduces secretion of α1-antitrypsin and haptoglobin

  • Ubiquitination-resistant ERGIC3 variants can restore secretion of these cargo proteins

These findings indicate that MARCH2's regulation of ERGIC3 is a key control point in the early secretory pathway, affecting the trafficking and secretion of specific cargo proteins.

How does MARCH2 compare structurally and functionally to CRL2Lrr1 in Xenopus laevis?

While both MARCH2 and CRL2Lrr1 are E3 ubiquitin ligases found in Xenopus laevis, they differ significantly in structure, targets, and cellular functions:

FeatureMARCH2CRL2Lrr1
StructureContains RING-CH domain and transmembrane domainsAdopts an unusually open architecture with substrate-recognition subunit (Lrr1) located far from the catalytic module
Primary targetsERGIC3, potential involvement in immune regulationMcm7 subunit of the replicative helicase (CMG)
Cellular roleEarly secretory pathway regulation, vesicular traffickingDNA replication termination
Activation mechanismConstitutively active, regulated by autoubiquitinationRecruited to CMGs only after replisomes converge to prevent premature replisome disassembly
Key domainsRING-CH domain essential for ligase activityFlexible pleckstrin homology domain at N-terminus of Lrr1 essential for targeting

CRL2Lrr1 specifically functions in DNA replication termination by ubiquitylating the Mcm7 subunit when replisomes from neighboring origins converge. This polyubiquitylated CMG is then disassembled by the p97 ATPase, leading to replication termination . In contrast, MARCH2 primarily regulates protein trafficking through the secretory pathway .

What role does MARCH2 play in cardiac pathology and inflammatory responses?

Recent research has identified MARCH2 as a protective factor in myocardial ischemia-reperfusion (I/R) injury. Single-cell RNA sequencing (scRNA-seq) of heart samples from mice with myocardial I/R injury revealed upregulation of MARCH2, which localizes primarily to the endoplasmic reticulum, endosome, Golgi apparatus, mitochondria, and plasma membranes .

MARCH2 ameliorates myocardial I/R injury through a mechanism involving:

  • Interaction with phosphoglycerate mutase family member 5 (PGAM5)

  • Promotion of K48-linked ubiquitination and degradation of PGAM5

  • Inhibition of phase-separated condensates of PGAM5-mitochondrial anti-viral-signaling protein (MAVS)

  • Subsequent suppression of NLRP3 inflammasome activation

These findings suggest that MARCH2 plays a crucial role in regulating inflammatory responses in cardiac tissue and may represent a novel therapeutic target for myocardial I/R injury.

What are the optimal conditions for handling recombinant Xenopus laevis MARCH2 protein?

For optimal handling and storage of recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH2, researchers should follow these guidelines:

  • Storage conditions:

    • Store at -20°C for routine use

    • For extended storage, conserve at -20°C or -80°C

    • Avoid repeated freezing and thawing

  • Working solution preparation:

    • Prepare working aliquots and store at 4°C for up to one week

    • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

  • Handling precautions:

    • Thaw on ice when removing from freezer

    • Centrifuge briefly before opening to ensure all material is at the bottom of the tube

    • Use sterile technique when handling to prevent contamination

Following these guidelines will help maintain the structural integrity and enzymatic activity of the recombinant protein for experimental use.

What experimental approaches can be used to study MARCH2-mediated ubiquitination of target proteins?

Several methodological approaches can be employed to investigate MARCH2-mediated ubiquitination:

  • Co-immunoprecipitation (Co-IP) assays:

    • Express tagged versions of MARCH2 and potential target proteins

    • Perform Co-IP to detect protein-protein interactions

    • Use western blotting with anti-ubiquitin antibodies to detect ubiquitinated species

  • Site-directed mutagenesis:

    • Generate MARCH2 variants with mutations in the RING-CH domain to create catalytically inactive controls

    • Create lysine-to-arginine substitutions in target proteins to identify specific ubiquitination sites (as demonstrated with ERGIC3 K6R/K8R mutations)

  • Ubiquitination assays:

    • In vitro ubiquitination using purified components (E1, E2, MARCH2, ubiquitin, ATP, and substrate)

    • Cell-based ubiquitination assays with HA-tagged ubiquitin to track ubiquitination events

  • Functional readouts:

    • Measure protein degradation rates using cycloheximide chase assays

    • Monitor protein secretion (for secretory pathway cargo proteins)

    • Assess target protein localization using immunofluorescence or subcellular fractionation

These approaches can be combined to provide comprehensive insights into MARCH2's ubiquitination targets and the functional consequences of these modifications.

How can researchers effectively use MARCH2 knockout or overexpression systems to study its function?

To investigate MARCH2 function through genetic manipulation, researchers can implement the following methodological approaches:

  • MARCH2 knockout systems:

    • CRISPR/Cas9-mediated gene editing to generate knockout cell lines or animal models

    • siRNA or shRNA for transient knockdown studies

    • Analysis of endogenous ERGIC3 levels as a positive control for successful MARCH2 depletion

    • For in vivo studies, utilize MARCH2 KO mouse models to investigate phenotypes such as response to myocardial I/R injury

  • MARCH2 overexpression systems:

    • Transient transfection with tagged MARCH2 constructs

    • Viral vector-mediated overexpression (e.g., AAV9-cTnT-MARCH2 for cardiac-specific expression)

    • Inducible expression systems to control timing and level of expression

    • Co-expression with potential substrate proteins to assess direct effects

  • Readout systems for functional analysis:

    • For protein trafficking studies: monitor secretion of α1-antitrypsin and haptoglobin as model cargo proteins

    • For cardiac protection studies: measure infarct size, cardiac function, and inflammasome activation markers

    • Biochemical analysis of PGAM5 ubiquitination and degradation in MARCH2 overexpression models

  • Control experiments:

    • Utilize catalytically inactive MARCH2 mutants as negative controls

    • Perform rescue experiments by reintroducing wild-type or mutant MARCH2 into knockout backgrounds

    • Include appropriate tissue-specific controls when using in vivo models

These approaches provide complementary strategies to dissect MARCH2 function across different biological contexts.

What techniques can be used to investigate the MARCH2 interactome and identify novel substrates?

To comprehensively map the MARCH2 interactome and identify novel substrates, researchers can employ several advanced techniques:

  • Mass spectrometry-based approaches:

    • Proximity-dependent biotin identification (BioID) or TurboID with MARCH2 as the bait protein

    • Stable isotope labeling with amino acids in cell culture (SILAC) combined with immunoprecipitation

    • Global protein stability profiling following MARCH2 manipulation

    • Ubiquitin remnant profiling to identify ubiquitination sites affected by MARCH2 expression

  • Protein-protein interaction screening:

    • Yeast two-hybrid screening with MARCH2 as bait

    • Protein complementation assays (e.g., split luciferase)

    • Co-immunoprecipitation followed by mass spectrometry

  • Validation of potential substrates:

    • Direct binding assays with recombinant proteins

    • In vitro and in vivo ubiquitination assays

    • Mutational analysis of potential ubiquitination sites

    • Assessment of protein stability and degradation in response to MARCH2 expression

  • Functional classification of interactors:

Interaction TypeValidation MethodFunctional Significance
Direct substratesUbiquitination assays, mutational analysisProteins directly ubiquitinated by MARCH2
Regulatory interactorsCo-IP, functional assays without ubiquitinationProteins that modulate MARCH2 activity
Complex componentsCo-IP, size exclusion chromatographyProteins that form part of MARCH2-containing complexes
Downstream effectorsSignaling assays, epistasis experimentsProteins affected by MARCH2 activity indirectly

These methodologies, especially when applied in combination, can reveal the full spectrum of MARCH2 substrates and interaction partners across different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.