Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3 (41336)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Xenopus laevis E3 Ubiquitin-Protein Ligase MARCH3 (41336)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3 (41336) is an enzyme that functions as an E3 ubiquitin ligase, potentially participating in endosomal trafficking . E3 ubiquitin ligases are crucial in the ubiquitination process, where they facilitate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate protein . Ubiquitination plays a key role in regulating various cellular processes, including protein degradation, signal transduction, and immune responses .

Function and Mechanism of E3 Ubiquitin Ligases

E3 ubiquitin ligases, such as MARCH3, mediate the final step in the ubiquitination cascade . They bind to both an E2 ubiquitin-conjugating enzyme and a target protein, facilitating the transfer of ubiquitin to the substrate . This process can lead to monoubiquitination or polyubiquitination of the target protein, with different outcomes . Polyubiquitination, for instance, often marks proteins for degradation by the proteasome .

MARCH Proteins: Key Regulators of Immune Response

Membrane-associated RING-CH-type finger (MARCH) proteins, including MARCH3, are E3 ubiquitin ligases that regulate immune responses . These proteins target immune receptors, viral proteins, and components of the innate immune response for polyubiquitination and degradation .

Regulation of MARCH3 Activity

The activity of MARCH ligases can be regulated by post-translational modifications such as phosphorylation . For example, TYRO3-mediated phosphorylation keeps MARCH3 inactive in unstimulated cells . Upon stimulation with IL-1β, CDC25A dephosphorylates MARCH3, activating it and causing K48-linked polyubiquitination and degradation of IL-1 receptor type I (IL-1RI), which inhibits IL-1β-triggered signaling .

Xenopus laevis Rmnd5 as an E3 Ubiquitin Ligase

Xenopus laevis Rmnd5, a Gid2 orthologue, functions as an E3 ubiquitin ligase within a high molecular weight complex . It targets an unknown factor for polyubiquitination and subsequent proteasomal degradation, which is essential for proper fore- and midbrain development .

In vitro Ubiquitination Assay

SampleUbiquitination Signal
Active X. laevis Rmnd5Strong
Rmnd5 Mutant (C354S)No autoubiquitination
Negative ControlsNo autoubiquitination
Human ubiquitin ligase HDM2Positive Control

This table summarizes the results of an in vitro polyubiquitination assay, demonstrating that active Xenopus laevis Rmnd5 exhibits a strong polyubiquitination signal .

The Decoy Approach for Identifying E3 Ubiquitin Ligases

A decoy approach can be employed to identify E3 ubiquitin ligases and overcome functional redundancy . This involves expressing an E3 ubiquitin ligase that lacks the ability to recruit the E2 conjugating enzyme but retains the ability to bind to the substrate . This inactivates the full-length E3 ubiquitin ligase and stabilizes the substrate protein, making it an effective tool for identifying redundant E3 ubiquitin ligases .

E3 Ubiquitin Ligases in Plant Stress Response

E3 ubiquitin ligases are involved in various processes, including responses to biotic and abiotic stresses in plants . For instance, the ATL subfamily, activated by elicitors, plays a role in disease resistance . Similarly, the U-box domain family of E3 ubiquitin ligases is important in defense responses .

U-Box E3 Ubiquitin Ligases in Salvia miltiorrhiza

In Salvia miltiorrhiza, U-box E3 (UBE3) ubiquitin ligases are involved in multiple biological processes and responses to plant stress . ABA treatment can upregulate several UBE3 genes, indicating their role in abscisic acid-mediated biological responses .

Expression Analysis of UBE3 Ubiquitin Ligases Under ABA Treatment

GeneExpression Level Under ABA Treatment
SmU-box4Highest
SmU-box12Highest
SmU-box14Highest
SmU-box15Highest
SmU-box17Highest
SmU-box18Highest
SmU-box25Highest
SmU-box32Highest
SmU-box36Highest
SmU-box45Highest
SmU-box55Highest
SmU-box58Highest
SmU-box59Highest

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
marchf3; march3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
march3
Target Protein Sequence
MTTSRCSHLPEVLPDCTSSAPSGKTVEDCSSLVNGQPQYVMQVSAKDGQLLSTVVRTLTT QSSFNDHPMCRICHEGSTQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRFS VERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRLE AVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILVIPKSANLPSAQQSLLGL HSFKRNSKETIV
Uniprot No.

Target Background

Function

MARCH3 (Membrane-Associated Ring Finger (C3HC4) 3) is an E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and subsequently transfer the ubiquitin to target substrates.

Database Links

KEGG: xla:779329

UniGene: Xl.52873

Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is E3 ubiquitin-protein ligase MARCH3 and what is its role in Xenopus laevis?

E3 ubiquitin-protein ligase MARCH3 (Membrane-associated RING finger protein 3, also known as Membrane-associated RING-CH protein III or MARCH-III) is a specialized E3 ligase containing a RING-CH domain. In the ubiquitination process, E3 ligases are responsible for substrate recognition and facilitating the transfer of ubiquitin from an E2 conjugating enzyme to the target protein. The ubiquitin proteasome system (UPS) regulates the targeted temporal and spatial degradation of proteins through this process, requiring the coordinated action of three enzyme classes: ubiquitin-activating enzyme (E1), ubiquitin-conjugating enzyme (E2), and finally the ubiquitin-ligase (E3) . While specific functions of MARCH3 in Xenopus laevis are not fully characterized, based on other E3 ligases in Xenopus, it likely plays important roles in developmental processes and protein homeostasis.

How does MARCH3 differ structurally from other E3 ubiquitin ligases in Xenopus laevis?

MARCH3 belongs to the RING-CH family of E3 ligases, which possess a specific type of RING finger domain. The RING domain typically contains 40-60 residues with a characteristic pattern of cysteine and histidine residues that coordinate zinc atoms. According to research on E3 ubiquitin ligases, different types exist including RING-HC, RING-H2, RING-v, RING-C2, RING-D, RING-S/T, and RING-G . MARCH3 specifically contains a RING-CH domain and, based on available sequence information, includes transmembrane domains suggesting its localization to cellular membranes. This differentiates it from other Xenopus E3 ligases like Rmnd5, which is part of the CTLH complex and contains a non-canonical RING domain .

What is known about the expression and developmental significance of MARCH3 in Xenopus laevis?

While specific expression data for MARCH3 in Xenopus laevis is limited in the provided research, we can draw comparisons with other E3 ligases in this organism. For example, Rmnd5, another E3 ubiquitin-ligase in Xenopus laevis, shows strong maternal contribution with expression declining until gastrulation, followed by lower levels of zygotic expression. Its expression is strongest in neuronal ectoderm, prospective brain, eyes, and ciliated cells of the skin . Similar developmental expression patterns may exist for MARCH3, though specific studies would be needed to confirm this. Understanding MARCH3's expression pattern would provide valuable insights into its potential developmental roles.

What methodologies are optimal for characterizing the E3 ligase activity of recombinant MARCH3?

To characterize the E3 ligase activity of recombinant Xenopus laevis MARCH3, researchers should employ in vitro ubiquitination assays similar to those used for other E3 ligases. Such assays typically include purified recombinant MARCH3, E1 activating enzyme, appropriate E2 conjugating enzyme(s), ubiquitin, ATP, and potential substrates. For example, studies with Rmnd5 from Xenopus laevis confirmed its E3 ubiquitin-ligase activity using in vitro polyubiquitination assays, where strong polyubiquitination signals were detected only in the presence of active Rmnd5 .

When testing E2 compatibility, it's advisable to screen multiple E2 enzymes, as different E3 ligases have preferences for particular E2 partners. For instance, the mammalian CTLH complex can pair with UBE2D1, UBE2D2, and UBE2D3 E2 enzymes . Similar screening would be valuable for identifying optimal E2 partners for MARCH3.

It's crucial to include appropriate controls in these assays, such as a catalytically inactive MARCH3 mutant (typically created by mutating key cysteine residues in the RING domain), reactions lacking ATP, and reactions lacking E1 or E2 enzymes.

How can researchers identify potential substrates for MARCH3 in Xenopus laevis systems?

Identifying substrates for E3 ubiquitin ligases remains challenging but several complementary approaches can be effective:

  • Proteomics-based approaches: Utilize immunoprecipitation followed by mass spectrometry to identify proteins that interact with MARCH3. This can be followed by validation using in vitro ubiquitination assays.

  • Comparative proteomics: Compare protein levels in systems with normal versus depleted/inhibited MARCH3 activity, as potential substrates may accumulate when the E3 ligase is inactive.

  • Genetic screens: Employ genetic approaches in Xenopus to identify genes that interact with MARCH3 through suppressor/enhancer screens or by analyzing phenotypic consequences of MARCH3 depletion.

  • Domain-based predictions: Analyze proteins for known recognition motifs that might be targeted by MARCH3.

As demonstrated with the CTLH complex, interdependence between complex members can be significant. For example, MAEA and RMND5A protein levels were found to be interdependent . Similar relationships may exist between MARCH3 and its interacting partners or substrates, which could provide clues about potential targets.

What types of ubiquitin chain linkages does MARCH3 preferentially catalyze, and how does this impact substrate fate?

Different ubiquitin chain linkages direct substrates to different cellular fates. For example, Lys48-linked and Lys11-linked poly-ubiquitin chains typically target proteins for degradation by the 26S proteasome, while Lys63-linked chains often function in protein activation and signaling pathways .

To determine the type of chains catalyzed by MARCH3, researchers should use in vitro ubiquitination assays with wild-type ubiquitin and ubiquitin mutants where specific lysine residues are mutated to arginine. Additionally, linkage-specific antibodies can be used to detect specific ubiquitin chain types. Mass spectrometry analysis can provide the most comprehensive assessment of chain types and architecture.

Some E3 ligases show flexibility in the types of chains they catalyze. For instance, recombinant RMND5A from the mammalian CTLH complex can mediate both K48 and K63 poly-ubiquitin chains . Determining whether MARCH3 shows similar flexibility would provide important insights into its cellular functions.

What are the optimal storage and handling conditions for recombinant Xenopus laevis MARCH3?

Based on product information for recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH3, optimal storage conditions include:

  • Long-term storage at -20°C or -80°C

  • Working aliquots at 4°C for up to one week

  • Storage in a Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoiding repeated freezing and thawing cycles

Storage PurposeTemperatureDurationBuffer Condition
Long-term storage-20°C or -80°CMonths to yearsTris-based with 50% glycerol
Working aliquots4°CUp to one weekSame as original
Experimental useOn iceHoursExperiment-dependent

These conditions help maintain protein stability and enzymatic activity. When designing experiments, it's advisable to prepare single-use aliquots to avoid the detrimental effects of freeze-thaw cycles on protein structure and function.

How should in vitro ubiquitination assays be optimized for MARCH3?

For optimal in vitro ubiquitination assays with MARCH3, consider the following methodological approaches:

  • Reaction components:

    • Purified recombinant MARCH3 (typically 0.1-1 μM)

    • E1 enzyme (50-100 nM)

    • E2 enzyme panel for initial screening (0.5-1 μM each)

    • Ubiquitin (10-50 μM)

    • ATP regeneration system (2-5 mM ATP, 10 mM creatine phosphate, 0.6 U/ml creatine kinase)

    • Buffer conditions (typically 50 mM Tris-HCl pH 7.5, 5 mM MgCl₂, 2 mM DTT)

  • Critical controls:

    • Reactions lacking ATP (negative control)

    • Reactions with catalytically inactive MARCH3 mutant (negative control)

    • Reactions lacking E1 or E2 (negative control)

    • Reactions with a well-characterized E3 ligase (positive control)

  • Detection methods:

    • Western blotting using anti-ubiquitin antibodies

    • Fluorescently labeled ubiquitin for real-time monitoring

    • Mass spectrometry for detailed analysis of ubiquitination sites and chain types

Similar methodologies have been successfully employed for other E3 ligases from Xenopus, such as Rmnd5, where in vitro polyubiquitination assays clearly demonstrated its ubiquitin-ligase activity .

What approaches can be used to study MARCH3 function in Xenopus laevis embryos?

To study MARCH3 function in Xenopus laevis embryos, researchers can employ several complementary approaches:

  • Expression analysis:

    • Temporal expression using semi-quantitative RT-PCR with total RNA from consecutive developmental stages

    • Spatial expression using whole mount in situ hybridization (WMISH)

    • Protein levels assessment via Western blotting at different developmental stages

  • Loss-of-function studies:

    • Morpholino antisense oligonucleotides targeting MARCH3 mRNA

    • CRISPR/Cas9-mediated gene editing

    • Dominant negative approaches using catalytically inactive MARCH3 mutants

  • Gain-of-function studies:

    • Microinjection of MARCH3 mRNA into embryos

    • Inducible expression systems

    • Tissue-specific overexpression

  • Phenotypic analysis:

    • Morphological examination

    • Histological analysis

    • Molecular marker analysis

    • Functional assays relevant to specific tissues

These approaches have been successfully used with other E3 ligases in Xenopus. For example, studies with Rmnd5 utilized RT-PCR to analyze temporal expression, WMISH for spatial expression, and suppression of Rmnd5 function revealed its importance in fore- and midbrain development .

How can researchers distinguish between specific and non-specific ubiquitination in MARCH3 assays?

Distinguishing between specific and non-specific ubiquitination is crucial for accurately interpreting results from MARCH3 assays. Researchers should implement the following strategies:

  • Control experiments:

    • Compare reactions with wild-type MARCH3 versus catalytically inactive mutant

    • Include reactions lacking substrate but containing all other components

    • Use unrelated proteins as negative controls for substrate specificity

    • Compare ubiquitination patterns across different E2 enzymes

  • Ubiquitination site mapping:

    • Use mass spectrometry to identify specific lysine residues modified by ubiquitin

    • Mutate identified lysines to determine if ubiquitination is abolished

    • Compare modification sites with known functional domains/motifs

  • Temporal analysis:

    • Monitor ubiquitination kinetics, as specific reactions often show distinct time courses

    • Analyze ubiquitination at different E3:substrate ratios

  • Competition assays:

    • Test whether excess unlabeled substrate can compete with labeled substrate

    • Specific interactions will show competition effects while non-specific ones typically won't

Similar approaches have been used with other E3 ligases, such as in studies with Rmnd5 where specific polyubiquitination signals were detected only with active enzyme and not with a RING domain mutant (C354S) .

What bioinformatic approaches can predict potential MARCH3 substrates?

Several bioinformatic approaches can help predict potential MARCH3 substrates:

  • Sequence motif analysis:

    • Identify consensus recognition sequences in known substrates

    • Search genomic and proteomic databases for proteins containing these motifs

    • Develop machine learning algorithms trained on known E3-substrate pairs

  • Structural modeling:

    • Generate 3D models of MARCH3-substrate interactions

    • Perform in silico docking studies to evaluate binding energetics

    • Use molecular dynamics simulations to assess stability of interactions

  • Evolutionary conservation analysis:

    • Compare MARCH3 across species to identify conserved domains likely involved in substrate recognition

    • Analyze co-evolution patterns between MARCH3 and potential substrates

  • Interaction network analysis:

    • Integrate data from protein-protein interaction databases

    • Consider cellular co-localization data

    • Analyze expression correlation patterns between MARCH3 and potential substrates

Bioinformatic ApproachKey Tools/DatabasesAdvantagesLimitations
Sequence motif analysisMEME, ScanProsite, ELMStraightforward, scalableHigh false positive rate
Structural modelingMODELLER, AutoDock, HADDOCKProvides mechanistic insightsComputationally intensive
Conservation analysisCLUSTAL, ConSurf, EvolutionaryTraceIdentifies functionally important residuesRequires high-quality alignments
Network analysisSTRING, BioGRID, REACTOMEIntegrates multiple data sourcesIndirect predictions

These approaches should be used in combination and validated experimentally to minimize false positives.

How should developmental expression data for MARCH3 be interpreted in the context of its potential functions?

Interpreting developmental expression data for MARCH3 requires careful consideration of several factors:

  • Temporal expression patterns:

    • Maternal versus zygotic contribution indicates potential roles in early development

    • Expression peaks may correspond to critical developmental windows

    • Correlation with developmental transitions suggests regulatory functions

  • Spatial expression patterns:

    • Tissue-specific expression indicates potential tissue-specific functions

    • Co-expression with potential substrates strengthens functional relationships

    • Comparison with other E3 ligases helps identify unique versus redundant functions

  • Comparative analysis:

    • Compare MARCH3 expression patterns with phenotypes observed in loss-of-function studies

    • Analyze expression conservation across species to identify evolutionarily conserved functions

    • Compare with expression of other ubiquitination machinery components

  • Integration with signaling pathways:

    • Correlate expression with known developmental signaling pathways

    • Analyze expression in response to pathway perturbations

    • Consider how MARCH3 might modulate different signaling outcomes

Based on studies with other Xenopus E3 ligases, such as Rmnd5, expression patterns can provide significant insights into function. For example, Rmnd5's strong expression in neuronal ectoderm, prospective brain, and eyes correlates with the observation that its suppression results in malformations of the fore- and midbrain . Similar correlative analyses could be valuable for understanding MARCH3 function.

How can findings from Xenopus MARCH3 studies inform understanding of human ubiquitination pathways?

Research on Xenopus laevis E3 ubiquitin ligases can provide valuable insights into human ubiquitination pathways due to evolutionary conservation of these systems. Cross-species comparisons can:

  • Identify conserved functions:

    • Compare substrate specificity between Xenopus and human MARCH3

    • Determine whether developmental roles are conserved

    • Assess conservation of regulatory mechanisms

  • Reveal species-specific adaptations:

    • Identify differences in expression patterns

    • Compare interaction networks

    • Analyze divergent structural features

  • Inform disease mechanisms:

    • Link findings to human disorders associated with ubiquitination defects

    • Provide model systems for testing potential therapeutic approaches

    • Elucidate fundamental mechanisms that may be dysregulated in disease

Despite high conservation, functional differences can exist between species. For example, when a yeast codon-optimized Xenopus laevis Rmnd5 was expressed in a gid2Δ deletion strain, it could not rescue the phenotype or interact with the yeast Gid complex, suggesting that structural differences prevent proper incorporation despite sequence homology .

What methodological considerations should be addressed when comparing E3 ligase activity across species?

When comparing E3 ligase activity across species, researchers should consider several methodological factors:

  • Protein expression systems:

    • Choose expression systems that provide proper post-translational modifications

    • Consider species-specific codon optimization for recombinant expression

    • Evaluate whether tags interfere with activity or interactions

  • Assay conditions:

    • Test multiple buffer conditions as optimal conditions may vary between orthologs

    • Screen diverse E2 enzymes as preferences may differ across species

    • Compare activity at different temperatures reflecting physiological conditions

  • Substrate conservation:

    • Assess whether putative substrates are conserved across species

    • Test cross-species substrate recognition

    • Consider differences in substrate regulation

  • Complex formation:

    • Determine whether the E3 ligase functions alone or in a complex

    • Assess conservation of complex components

    • Test whether components can be interchanged between species

Cross-species functional studies, like those performed with Rmnd5 between yeast and Xenopus systems, highlight the importance of these considerations. Despite the high degree of conservation between Gid2 (yeast) and Rmnd5 (Xenopus), structural differences prevented the Xenopus protein from functioning in the yeast system .

What are the key unanswered questions regarding MARCH3 function in Xenopus laevis?

Several critical questions remain to be addressed regarding MARCH3 function in Xenopus laevis:

  • Substrate identification:

    • What are the physiological substrates of MARCH3?

    • How does substrate specificity compare with mammalian MARCH3?

    • Are there developmental stage-specific substrates?

  • Regulation mechanisms:

    • How is MARCH3 activity regulated during development?

    • What post-translational modifications affect MARCH3 function?

    • Do MARCH3 protein levels correlate with activity?

  • Developmental roles:

    • What specific developmental processes require MARCH3?

    • How does MARCH3 compare functionally with other E3 ligases in Xenopus?

    • Are there tissue-specific functions?

  • Structure-function relationships:

    • Which domains are critical for substrate recognition?

    • How does membrane association affect function?

    • What structural features determine E2 enzyme preferences?

Addressing these questions will require integrated approaches combining biochemistry, developmental biology, and structural biology methods.

How might emerging technologies advance the study of MARCH3 and other E3 ubiquitin ligases?

Emerging technologies offer promising avenues for advancing the study of MARCH3 and other E3 ubiquitin ligases:

  • Advanced proteomics:

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners in living cells

    • Ubiquitinome analysis using selective enrichment strategies

    • Single-cell proteomics to reveal cell-type-specific functions

  • CRISPR technologies:

    • Base editing for introducing precise mutations

    • Prime editing for versatile genomic modifications

    • CRISPR activation/inhibition for controlled expression modulation

  • Structural biology advances:

    • Cryo-electron microscopy for complex structures

    • Integrative structural biology combining multiple data types

    • AlphaFold and similar AI approaches for structure prediction

  • Live-cell imaging:

    • FRET-based sensors for monitoring ubiquitination in real-time

    • Optogenetic control of E3 ligase activity

    • Super-resolution microscopy for visualizing ubiquitination events

TechnologyApplication to E3 Ligase ResearchCurrent Limitations
Proximity labelingIn vivo substrate identificationBackground labeling
CRISPR screeningFunctional genomics of E3 networksOff-target effects
AlphaFoldStructure prediction for design of inhibitorsDynamic interactions poorly predicted
OptogeneticsSpatiotemporal control of E3 activitySystem complexity

These technologies will enable researchers to study E3 ligases with unprecedented precision and may reveal novel functions and regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.