Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH5 (41338)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

MARCH5 regulates mitochondrial dynamics through ubiquitination-dependent mechanisms:

  • Mitochondrial Fission: Modulates Drp1 (dynamin-related protein 1) assembly at fission sites. MARCH5 RING mutants disrupt Drp1 trafficking, causing mitochondrial elongation .

  • Substrate Ubiquitination: Targets mitofusin-1 (Mfn1) and hFis1 for proteasomal degradation. Loss of MARCH5 increases Mfn1 levels, inducing mitochondrial hyperfusion and cellular senescence .

  • Quality Control: Degrades misfolded mitochondrial proteins, maintaining organelle integrity .

Key Research Findings

Study FocusMethodology & ResultsCitation
Drp1 RegulationMARCH5 RING mutants caused mitochondrial elongation; rescued by Drp1 overexpression.
Cellular SenescenceMARCH5 knockdown increased senescence-associated β-galactosidase activity via Mfn1 accumulation.
Ubiquitination AssayIn vitro assays confirmed MARCH5’s E3 ligase activity, requiring an intact RING domain.

Applications in Research

  • Mitochondrial Dynamics: Used to study fission/fusion balance in neurodegenerative diseases and cancer .

  • Ubiquitination Pathways: Explores E3 ligase mechanisms using reconstituted systems .

  • Therapeutic Targets: Investigated in cancers where MARCH5 dysregulation alters mitochondrial homeostasis .

Comparative Insights

  • Species Conservation: MARCH5 homologs exist in humans (MARCHF5) and yeast (Gid2), though functional divergence occurs. Xenopus MARCH5 failed to complement yeast Gid2 mutants, highlighting evolutionary specialization .

  • Cancer Relevance: MARCH5’s dual role as oncogene/tumor suppressor depends on substrate context (e.g., stabilizing pro-survival factors or degrading tumor suppressors) .

Technical Considerations

  • Handling: Avoid repeated freeze-thaw cycles; aliquot for stability .

  • Activity Validation: Use in vitro ubiquitination assays with wild-type vs. C354S RING mutants as negative controls .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag if possible.
Synonyms
marchf5; march5; E3 ubiquitin-protein ligase MARCHF5; Membrane-associated RING finger protein 5; Membrane-associated RING-CH protein V; MARCH-V; RING-type E3 ubiquitin transferase MARCHF5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
march5
Target Protein Sequence
MSESNSVSVQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRG NSTARVACPQCNAEYLIVFPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYG AVTVMQVVGHKEGLDVMERADPLFLLIGLPTIPVVLILGKMIRWEDYVLRLWRKYSNKLQ ILNSIFPGIGCPVPRVPAEANPLADHVSATRILCGALVFPTIATIVGKLMFSTVNSNLQR TILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILDSQEPEPEEV
Uniprot No.

Target Background

Function
Mitochondrial E3 ubiquitin-protein ligase MARCH5 (41338) is a crucial regulator of mitochondrial morphology, functioning as a positive regulator of mitochondrial fission. It plays a significant role in the control of mitochondrial quality control, potentially contributing to the prevention of cellular senescence.
Database Links

KEGG: xla:444564

UniGene: Xl.19345

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage and reconstitution conditions for working with MARCH5?

For optimal stability and activity, the lyophilized protein should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles. Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and aliquot for storage at -20°C/-80°C. The standard recommended final concentration of glycerol is 50%. The reconstituted protein is stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How does MARCH5 from Xenopus laevis compare to homologues in other model organisms?

While specific comparative data for MARCH5 across species is limited in the provided search results, we can draw insights from studies of other E3 ubiquitin ligases in Xenopus. For example, the Rmnd5 E3 ubiquitin-ligase from Xenopus laevis shares functional similarities with its yeast ortholog Gid2, but exhibits significant structural differences in protein binding domains that prevent cross-species complementation.

When expressed in a yeast gid2Δ deletion strain, Xenopus Rmnd5 was unable to rescue the phenotype or interact with the yeast Gid complex despite high sequence conservation . This suggests that while E3 ligases like MARCH5 may share conserved catalytic domains across species, their substrate specificity and protein-protein interaction networks are likely species-specific, necessitating model-specific research approaches.

What expression systems are typically used for producing recombinant Xenopus laevis MARCH5?

For studies requiring post-translational modifications or proper membrane protein folding, alternative expression systems such as insect cells (baculovirus) or mammalian expression systems might be more appropriate, though these are not documented in the provided search results for MARCH5 specifically.

What are the methodological considerations for assessing MARCH5 E3 ligase activity in vitro?

Based on methodologies used for other Xenopus E3 ubiquitin ligases, the following protocol can be adapted for MARCH5:

In vitro ubiquitination assay for MARCH5:

  • Combine purified recombinant MARCH5 (1-5 μg) with:

    • Ubiquitin (5-10 μg)

    • E1 ubiquitin-activating enzyme (50-100 ng)

    • E2 ubiquitin-conjugating enzyme (0.5-1 μg)

    • ATP regeneration system (2 mM ATP, 10 mM creatine phosphate, 3.5 U/mL creatine kinase)

    • Reaction buffer (50 mM Tris-HCl pH 7.5, 5 mM MgCl₂, 2 mM DTT)

  • Incubate the reaction mixture at 30°C for 1-3 hours.

  • Terminate the reaction by adding SDS-PAGE loading buffer and heating at 95°C for 5 minutes.

  • Analyze by SDS-PAGE followed by western blotting using anti-ubiquitin antibodies.

A negative control should include a catalytically inactive MARCH5 mutant (typically with mutation in the RING domain's conserved cysteine residues). As demonstrated with Rmnd5, mutation of conserved RING cysteine residues (e.g., C354S in Rmnd5) abolishes E3 ligase activity .

How can I investigate the subcellular localization and protein interactions of MARCH5 in Xenopus embryos?

To investigate MARCH5 subcellular localization and protein interactions in Xenopus embryos, consider the following methodological approach:

  • Subcellular localization:

    • Microinjection of mRNA encoding fluorescently tagged MARCH5 into fertilized Xenopus eggs

    • Live imaging of early embryos using confocal microscopy

    • Alternatively, perform immunohistochemistry on fixed embryo sections using anti-MARCH5 antibodies

  • Protein interaction studies:

    • Co-immunoprecipitation (Co-IP) from embryo lysates:

      • Prepare lysates from stage-specific embryos

      • Perform immunoprecipitation with anti-MARCH5 antibodies

      • Analyze precipitated proteins by mass spectrometry

    • Proximity labeling techniques (BioID or APEX)

    • Yeast two-hybrid screening

  • Glycerol density centrifugation to assess complex formation:
    As demonstrated with Rmnd5, glycerol density centrifugation can determine if MARCH5 is part of a high molecular weight complex. Protocol outline:

    • Prepare embryo lysates from specific developmental stages (e.g., stage 36)

    • Layer lysates onto 10-40% glycerol gradients

    • Centrifuge at 150,000 × g for 18 hours

    • Collect fractions and analyze by western blotting using anti-MARCH5 antibodies

    • Compare fractionation pattern with known molecular weight markers

What approaches can be used to study the developmental roles of MARCH5 in Xenopus laevis?

To investigate the developmental roles of MARCH5 in Xenopus, consider these methodological approaches:

  • Morpholino-mediated knockdown:

    • Design antisense morpholino oligonucleotides targeting MARCH5 mRNA

    • Microinject morpholinos into fertilized eggs

    • Assess phenotypes at various developmental stages using the Xenopus normal table as reference

    • Validate knockdown efficiency by RT-PCR and western blotting

  • CRISPR/Cas9-mediated genome editing:

    • Design sgRNAs targeting MARCH5 coding sequence

    • Microinject Cas9 protein/mRNA and sgRNAs into fertilized eggs

    • Screen F0 embryos for mutations and phenotypes

    • Establish knockout lines for detailed analysis

  • Tissue-specific and temporal analysis:

    • Perform whole-mount in situ hybridization to characterize MARCH5 expression patterns across developmental stages

    • Compare with known developmental markers

    • Based on expression patterns, focus functional studies on relevant tissues/organs

  • Rescue experiments:

    • Co-inject morpholinos with wild-type MARCH5 mRNA to demonstrate specificity

    • Compare rescue efficiency between wild-type and catalytically inactive MARCH5

Given the expression pattern observed with other E3 ligases like Rmnd5 (predominantly in neuronal ectoderm, prospective brain, eyes, and ciliated cells ), particular attention should be paid to these tissues when analyzing MARCH5 function.

How can potential substrates of MARCH5 be identified in Xenopus laevis?

Identifying E3 ubiquitin ligase substrates is challenging but can be approached using several complementary methods:

  • Proteomics-based approaches:

    • Quantitative proteomics: Compare protein levels in MARCH5 knockout/knockdown versus control embryos

    • Ubiquitin remnant profiling: Enrich for ubiquitinated peptides using K-ε-GG antibodies followed by mass spectrometry

    • Proximity-dependent biotin identification (BioID): Fuse MARCH5 to a biotin ligase to biotinylate nearby proteins

  • Candidate-based approaches:

    • Based on known MARCH5 substrates in other species

    • Focus on proteins showing increased abundance in MARCH5-depleted embryos

    • Test direct ubiquitination in vitro

  • Yeast two-hybrid screening:

    • Use MARCH5 as bait to screen Xenopus cDNA libraries

    • Validate interactions by co-immunoprecipitation

  • In vivo validation protocol:

    • Test whether candidate substrate levels increase upon MARCH5 depletion

    • Examine if proteasome inhibition (e.g., with MG132) further increases substrate levels

    • Perform in vitro ubiquitination assays with purified components

    • Demonstrate direct interaction between MARCH5 and substrate

    • Map ubiquitination sites on the substrate

What are the technical considerations for analyzing MARCH5 activity in different Xenopus developmental stages?

Analyzing MARCH5 activity across developmental stages requires consideration of stage-specific experimental conditions:

  • Stage-appropriate protein extraction:

    • Early embryonic stages (1-12): Use extraction buffers containing higher detergent concentrations to account for high yolk content

    • Post-gastrulation stages: Standard lysis buffers are typically sufficient

    • Use the Normal Table of Xenopus Development to accurately identify stages

  • Developmental timing considerations:

    • Design experiments around key developmental transitions:

      • Maternal-to-zygotic transition (~stage 8-9)

      • Gastrulation (~stage 10-12)

      • Neurulation (~stage 14-20)

      • Organogenesis (~stage 24-45)

  • Tissue-specific analysis:

    • For later stages, consider micro-dissection of specific tissues prior to analysis

    • Adapt protein extraction protocols for tissue-specific requirements

  • Stage-specific ubiquitination assays:

    • Extract native E2 enzymes from stage-specific embryos to identify preferred E2 partners

    • Compare ubiquitination activity across developmental stages

    • Consider stage-specific cofactors that might regulate MARCH5 activity

  • Technical adaptation table for developmental stages:

Developmental PeriodStagesProtein Extraction BufferSpecial Considerations
Fertilization to MBT1-8High detergent (1% Triton X-100, 0.5% deoxycholate)High yolk content; maternal proteins dominant
Gastrulation10-12Standard lysis buffer with protease inhibitorsBeginning of zygotic transcription
Neurulation14-20Standard lysis bufferConsider neural tissue-specific extraction
Organogenesis24-35Tissue-specific extractionMicro-dissection recommended
Tadpole36-45Tissue-specific extractionConsider organ-specific analysis

What controls should be included when studying MARCH5 function in Xenopus laevis?

When designing experiments to study MARCH5 function in Xenopus, the following controls are essential:

  • For knockdown/knockout studies:

    • Negative control morpholino/sgRNA (non-targeting)

    • Rescue experiments with wild-type MARCH5 mRNA

    • Rescue with catalytically inactive MARCH5 (RING domain mutant)

    • Dose-response analysis to determine optimal morpholino concentration

  • For ubiquitination assays:

    • Negative control: Reaction without MARCH5

    • Negative control: Reaction with catalytically inactive MARCH5 mutant

    • Positive control: Known E3 ubiquitin ligase (e.g., HDM2 as used in Rmnd5 studies )

    • E2 enzyme controls: Test multiple E2 enzymes to identify preferred partners

  • For localization studies:

    • Untagged fluorescent protein control

    • C-terminal and N-terminal tagged versions to ensure tag position doesn't interfere with localization

    • Co-localization with known organelle markers

  • For developmental studies:

    • Stage-matched wild-type controls

    • Careful staging according to the Normal Table of Xenopus Development

    • Uninjected controls and control-injected embryos

How can I troubleshoot issues with recombinant MARCH5 activity in biochemical assays?

Common issues with recombinant E3 ligase activity and their solutions include:

  • Problem: Low or no detectable ubiquitination activity

    Potential solutions:

    • Verify protein integrity by SDS-PAGE and western blotting

    • Ensure proper protein folding by testing different expression and purification conditions

    • Try different E2 conjugating enzymes (MARCH5 may have specific E2 preferences)

    • Optimize reaction conditions (pH, salt concentration, temperature)

    • Add zinc (10-50 μM ZnCl₂) to reaction buffer to stabilize RING domain

    • Ensure recombinant protein is stored properly to maintain activity

  • Problem: High background in ubiquitination assays

    Potential solutions:

    • Use freshly prepared reagents

    • Include deubiquitinating enzyme inhibitors in reaction buffer

    • Purify E1, E2, and E3 enzymes to high homogeneity

    • Reduce reaction time to minimize non-specific activity

    • Optimize antibody dilutions for western blotting

  • Problem: Inconsistent results between experiments

    Potential solutions:

    • Standardize protein concentration measurement methods

    • Aliquot enzymes and substrates to avoid freeze-thaw cycles

    • Use internal controls for normalization

    • Maintain consistent reaction conditions across experiments

    • Consider the age of reagents and protein preparations

What are the methodological differences when working with MARCH5 in Xenopus laevis versus Xenopus tropicalis?

When transitioning between Xenopus species, consider these methodological adjustments:

  • Genomic considerations:

    • Xenopus laevis is allotetraploid with a complex genome

    • Xenopus tropicalis has a diploid genome, simplifying genetic studies

    • Design species-specific primers and morpholinos accounting for paralogues in X. laevis

  • Developmental timing:

    • X. tropicalis develops more rapidly than X. laevis

    • Adjust experimental timepoints accordingly

    • Use species-specific normal tables for accurate staging

  • Experimental protocols:

    • Morpholino/mRNA injection volumes: Typically smaller for X. tropicalis eggs

    • Protein extraction yields: Generally lower from X. tropicalis due to smaller size

    • Temperature: X. tropicalis is typically maintained at higher temperatures (25-28°C) than X. laevis (18-22°C)

  • Sequence considerations:

    • Design species-specific reagents (antibodies, primers, probes)

    • Account for potential differences in MARCH5 paralogues in X. laevis

    • Consider conservation of interaction partners and substrates between species

While specific data for MARCH5 comparison between species is not provided in the search results, these general considerations apply based on established Xenopus research practices .

What statistical approaches are appropriate for analyzing MARCH5 activity across developmental stages?

When analyzing MARCH5 activity across developmental stages, consider these statistical approaches:

  • For quantitative western blot analysis:

    • Minimum of 3-5 biological replicates per stage

    • Normalization to appropriate loading controls (tubulin, GAPDH, total protein)

    • One-way ANOVA with post-hoc tests for multi-stage comparisons

    • Report both fold-changes and p-values

  • For phenotypic analysis:

    • Categorize phenotypes into defined classes

    • Minimum sample size of 30-50 embryos per condition

    • Chi-square test for categorical data

    • Fisher's exact test for smaller sample sizes

    • Report percentages with 95% confidence intervals

  • For proteomics data:

    • Multiple test correction (e.g., Benjamini-Hochberg procedure)

    • Volcano plots showing fold-change vs. statistical significance

    • Pathway enrichment analysis of differentially abundant proteins

    • Clustering analysis to identify co-regulated proteins

  • Sample size considerations:

Analysis TypeMinimum Sample SizeStatistical TestSpecial Considerations
Western blot3-5 biological replicatest-test or ANOVANormalize to loading controls
qPCR3 biological replicates with technical triplicatest-test or ANOVAUse reference genes for normalization
Embryo phenotypes30-50 embryos per conditionChi-square or Fisher's exactBlind scoring recommended
Proteomics3-4 biological replicatesModerated t-testMultiple test correction essential

How do I reconcile contradictory findings when comparing MARCH5 function in Xenopus with other model organisms?

When faced with contradictory findings between Xenopus and other models, consider this systematic approach:

  • Evaluate methodological differences:

    • Compare protein expression systems used (bacterial vs. eukaryotic)

    • Assess activity assay conditions (buffer composition, temperature, pH)

    • Review knockout/knockdown strategies for differences in efficiency or specificity

  • Consider evolutionary context:

    • Analyze sequence conservation of MARCH5 between species

    • Compare conservation of substrate recognition motifs

    • Examine evolutionary divergence of interaction partners

    • As seen with Rmnd5, despite high conservation, Xenopus E3 ligases may not functionally complement their yeast orthologs due to differences in protein binding domains

  • Developmental context:

    • Different model organisms may emphasize different developmental processes

    • Xenopus studies often focus on early development, while mammalian studies may examine adult tissues

    • Tissue-specific roles may vary across species

  • Reconciliation strategies:

    • Design hybrid experiments combining techniques across model systems

    • Test conservation of substrate recognition directly

    • Perform cross-species complementation studies

    • Resolve contradictions through collaboration with labs specialized in different model organisms

What are emerging techniques that could advance our understanding of MARCH5 function in Xenopus?

Several cutting-edge approaches could significantly advance MARCH5 research in Xenopus:

  • Single-cell proteomics:

    • Analyze MARCH5-dependent proteome changes at single-cell resolution

    • Identify cell type-specific substrates and pathways

    • Map proteomic changes to developmental trajectories

  • Proximity labeling in vivo:

    • Express MARCH5 fused to TurboID or APEX2 in Xenopus embryos

    • Map the MARCH5 interaction landscape in specific tissues and developmental stages

    • Identify transient interactions that may be missed by traditional co-IP

  • Optogenetic control of MARCH5 activity:

    • Develop light-controllable versions of MARCH5

    • Enable spatial and temporal control of ubiquitination activity

    • Study acute versus chronic effects of MARCH5 activity

  • CRISPR-based screens in Xenopus:

    • Develop pooled CRISPR screening methods adapted for Xenopus

    • Identify genetic modifiers of MARCH5 phenotypes

    • Discover synthetic lethal interactions

  • Cryo-EM structural studies:

    • Determine the structure of MARCH5 alone and in complex with substrates

    • Identify conformational changes during the ubiquitination cycle

    • Guide the development of specific inhibitors or activators

How might MARCH5 research in Xenopus contribute to understanding human diseases?

MARCH5 research in Xenopus has potential applications for human disease understanding:

  • Neurodevelopmental disorders:

    • Given the role of other E3 ligases like Rmnd5 in brain development , MARCH5 may have similar neurodevelopmental functions

    • Xenopus models could help understand how MARCH5 mutations affect brain development

    • Potential relevance to microcephaly, autism spectrum disorders, or intellectual disability

  • Cancer biology:

    • E3 ubiquitin ligases are frequently dysregulated in cancer

    • Xenopus studies could identify novel MARCH5 substrates relevant to cell cycle control or apoptosis

    • Potential applications in identifying new therapeutic targets

  • Metabolic disorders:

    • Ubiquitin ligases play key roles in metabolic regulation

    • Xenopus allows study of metabolic programming during early development

    • Potential insights into diabetes, obesity, or mitochondrial disorders

  • Translational pipeline:

    • Initial discovery in Xenopus → Validation in mammalian cells → Mouse models → Clinical correlation

    • Xenopus offers advantages in speed, cost, and embryo accessibility for initial discovery

How do findings from MARCH5 research integrate with our broader understanding of ubiquitin ligases in development?

MARCH5 research in Xenopus contributes to a growing body of evidence that E3 ubiquitin ligases play critical roles in developmental regulation. The developmental functions of E3 ligases like Rmnd5, which affects fore- and midbrain development , suggest that protein degradation pathways are precisely regulated during embryogenesis.

The study of MARCH5 and other E3 ligases in Xenopus complements research in other model organisms, highlighting conserved mechanisms of protein quality control and regulatory degradation. As a vertebrate model with external development and well-characterized developmental stages , Xenopus offers unique advantages for studying how ubiquitin ligases interface with developmental signaling networks.

By integrating findings across different E3 ligases, researchers can build a more comprehensive understanding of how protein degradation networks coordinate complex developmental processes. This integrative approach may ultimately reveal common principles of ubiquitin-mediated regulation that apply across diverse developmental contexts and species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.