Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-A (rnf152-a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus laevis E3 Ubiquitin-Protein Ligase RNF152-A (RNF152-A)

Recombinant Xenopus laevis E3 ubiquitin-protein ligase RNF152-A (RNF152-A) is a bioengineered protein derived from the RNF152 gene isoform in African clawed frogs (Xenopus laevis). This recombinant protein is produced in E. coli with a His-tag for purification and is characterized by its lysosomal localization and dual roles in signaling pathways. RNF152-A belongs to the RING domain family of E3 ubiquitin ligases, which typically mediate protein ubiquitination to regulate cellular processes such as apoptosis, immune signaling, and development .

Production and Purity

ParameterValueSource
Host OrganismE. coli
TagN-terminal His-tag
Purity≥85% (SDS-PAGE) or ≥90% (Creative BioMart)
StorageLyophilized powder stored at -20°C/-80°C; reconstituted in deionized water

Functional Roles and Mechanisms

RNF152-A exhibits both E3 ligase-dependent and -independent activities, depending on the signaling context:

E3 Ligase-Dependent Functions

  1. Apoptosis Regulation:

    • RNF152-A induces apoptosis via pro-apoptotic pathways, though this is not fully characterized in Xenopus .

  2. mTORC1 Inhibition:

    • In mammals, RNF152 ubiquitinates RagA/Rheb GTPases to suppress mTORC1 activity, a process dependent on its E3 ligase activity .

E3 Ligase-Independent Functions

  1. Wnt/β-Catenin Signaling Inhibition:

    • RNF152-A blocks Wnt/β-catenin signaling by inhibiting Dishevelled polymerization, a critical step in pathway activation. This function requires its TM domain but not E3 ligase activity .

    • Phenotype: Overexpression in Xenopus embryos disrupts neural crest (NC) formation, while depletion enhances NC markers .

  2. TLR/IL-1R Signaling Modulation:

    • In mammals, RNF152-A facilitates MyD88 oligomerization to enhance NF-κB activation. This role is independent of its enzymatic activity .

Experimental Models

  • Wnt/β-Catenin Pathway Studies:

    • Xenopus embryos injected with RNF152-A mRNA show reduced β-catenin levels and altered NC development .

    • Mechanism: Inhibits Dishevelled polymerization, disrupting Wnt signal transduction .

  • TLR/IL-1R Signaling:

    • RNF152-A enhances MyD88 self-association in vitro, promoting IRAK1 recruitment and downstream cytokine production .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rnf152-a; rnf152; E3 ubiquitin-protein ligase rnf152-A; RING finger protein 152-A; RING-type E3 ubiquitin transferase rnf152-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnf152-a
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKRTCCSVCLQQMRACQKDLRCPWCRGVTKL PPGYSVSQLPDDPDVVAVITIPHASENTPVFIKLPSNGCYMWPLPVSKERALLPGDIGCR LLPGNQQKPVTVVTMPMEQQPLHGNIPQDIVEEEHERRGVVKSSTWSGICTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function
Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-A (rnf152-a) is an E3 ubiquitin-protein ligase. It mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation, thereby regulating mTORC1 signaling and cellular response to amino acid availability. It also mediates Lys-48-linked polyubiquitination of target proteins, leading to proteasomal degradation.
Database Links

KEGG: xla:444373

UniGene: Xl.47605

Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

How is RNF152 expressed during Xenopus embryonic development?

In Xenopus embryonic development, RNF152 expression shows specific spatial and temporal patterns. Studies indicate that RNF152 controls Wnt/β-catenin signaling during early embryogenesis, particularly in neural crest (NC) formation . RNF152 is expressed in the floor plate (FP) of the neural tube, which corresponds to cells exposed to high concentrations of Sonic hedgehog (Shh) . Interestingly, while RNF152 expression is not detected at Hamburger-Hamilton (HH) stage 11, it becomes detectable in the floor plate at HH stages 16 and 22, with lower expression levels in the apical region of the neural tube . This expression pattern correlates with its role in restricting cell proliferation in the floor plate, which typically has a low proliferation rate despite being exposed to high levels of Shh .

What are the primary substrates of RNF152?

RNF152 has several identified substrates, each associated with different signaling pathways:

  • RagA: RNF152 mediates K63-linked polyubiquitination of RagA in response to amino acid starvation, negatively regulating mTORC1 signaling . This ubiquitination recruits GATOR1, leading to RagA inactivation and mTORC1 release from the lysosomal surface .

  • Dishevelled (Dsh): In Wnt/β-catenin signaling, RNF152 affects Dishevelled polymerization in an E3 ligase-independent manner. Rather than ubiquitinating Dsh, RNF152 inhibits Dsh self-association and puncta formation, which are crucial for signalosome assembly and downstream Wnt signaling .

  • Self-ubiquitination: RNF152 can ubiquitinate itself, leading to a short half-life through autoubiquitination activity. The E3 ligase-defective RNF152(CS) mutant shows increased steady-state protein levels compared to wild-type RNF152, suggesting that its E3 ligase activity affects its own stability .

Experimental identification of RNF152 substrates typically involves co-immunoprecipitation experiments, ubiquitination assays, and mutational analyses to confirm the specificity of interactions .

How does RNF152 regulate Wnt/β-catenin signaling in Xenopus development?

RNF152 functions as a negative regulator of Wnt/β-catenin signaling during Xenopus early embryogenesis through several mechanisms:

  • Inhibition of β-catenin stabilization: Overexpression of wild-type RNF152 reduces endogenous β-catenin levels in animal cap cells and interferes with XWnt8-induced increases in β-catenin levels .

  • Suppression of target gene expression: RNF152 blocks the transcription of Wnt target genes such as siamois and Xnr3 in response to XWnt8 stimulation .

  • Inhibition of Dishevelled polymerization: Mechanistically, RNF152 inhibits the self-association of Dishevelled proteins and the formation of their cytoplasmic puncta in an E3 ligase-independent manner . This disrupts signalosome formation, which is crucial for inhibiting GSK3-mediated phosphorylation of β-catenin.

  • Transmembrane domain requirement: Importantly, the membrane localization of RNF152 (mediated by its TM domain) is essential for its inhibitory function, while its E3 ligase activity is dispensable. The RNF152(CS) mutant (lacking E3 ligase activity) can still inhibit Wnt signaling, but the RNF152(dTM) mutant (lacking the transmembrane domain) cannot .

This negative regulation by RNF152 helps fine-tune Wnt/β-catenin signaling activity for proper neural crest formation in the Xenopus embryo .

What is the role of RNF152 in mTOR signaling and how does it affect cell proliferation?

RNF152 serves as a negative regulator of mTOR signaling through the following mechanisms:

  • RagA ubiquitination: RNF152 ubiquitinates the GDP-bound form of RagA, a small GTPase essential for mTORC1 activation . This ubiquitination targets RagA for degradation, thereby negatively regulating mTOR signaling .

  • Cell proliferation inhibition: In neural tube development, RNF152 restricts cell proliferation by blocking mTOR signaling. Overexpression of RNF152 leads to downregulation of phosphorylated p70S6K (p-p70S6K), a downstream effector of mTOR, and reduces the number of phosphorylated histone H3 (pHH3)-positive cells, indicating decreased cell proliferation .

  • FoxA2 regulation: In floor plate cells, RNF152 is a target gene of the transcription factor FoxA2, which is essential for restricting cell proliferation. This regulatory axis (FoxA2→RNF152→RagA→mTOR) helps explain why floor plate cells exposed to high levels of Shh have a low proliferation rate .

  • Rescue by constitutively active RagA: The inhibitory effect of RNF152 on cell proliferation can be rescued by co-expression of constitutively active RagA (CA-RagA), confirming that RagA is downstream of RNF152 in this pathway .

Experimental evidence demonstrates that loss of RNF152 function (via siRNA knockdown) leads to aberrant mTOR signaling activation in floor plate cells, as indicated by increased phosphorylated S6 (pS6) expression and abnormal cell proliferation (pHH3-positive cells) in the floor plate .

How does RNF152 contribute to neural crest formation?

RNF152 plays a critical role in neural crest (NC) formation through its regulation of Wnt/β-catenin signaling:

  • Negative regulation of NC specification: Gain-of-function experiments show that overexpression of RNF152 inhibits the expression of neural crest markers (Slug, Sox9, and Sox10) both in animal cap assays and in vivo in neurulae .

  • Loss-of-function effects: Conversely, knockdown of RNF152 using morpholinos (MOs) enhances the expression of NC markers in response to Wnt and BMP antagonist (noggin) signals, and expands the NC marker-positive area in neurulae .

  • Developmental consequences: RNF152 morphants (embryos with reduced RNF152 function) exhibit defects in craniofacial structures and pigmentation, consistent with disrupted neural crest development .

  • Fine-tuning mechanism: These results suggest that RNF152 acts as a fine-tuning mechanism for Wnt/β-catenin signaling during neural crest formation, ensuring appropriate levels of signaling activity for proper development .

Experimental approaches to study RNF152's role in neural crest formation include animal cap assays, targeted microinjection of RNF152 mRNA or morpholinos into Xenopus embryos, and in situ hybridization to detect changes in neural crest marker expression .

What are effective approaches for studying RNF152 function in Xenopus?

Several experimental approaches have proven effective for studying RNF152 function in Xenopus:

  • Animal cap assays: This widely used technique involves isolating the animal pole region of blastula-stage embryos and treating these explants with specific factors. For RNF152 studies, researchers have used this method to analyze the effects of RNF152 on Wnt/β-catenin signaling by co-injecting XWnt8 and RNF152 mRNAs and examining β-catenin levels and target gene expression .

  • Targeted microinjection: Injecting RNF152 mRNA or morpholinos into specific blastomeres at early cleavage stages allows for the manipulation of RNF152 function in defined regions of the embryo. This approach has been used to examine the effects of RNF152 gain or loss of function on neural crest marker expression in vivo .

  • In situ hybridization: This technique has been employed to detect the spatial expression patterns of RNF152 during development, as well as to assess changes in the expression of neural crest markers (Slug, Sox9, Sox10) following RNF152 manipulation .

  • RT-PCR/RT-qPCR: These methods have been used to quantify changes in gene expression in response to RNF152 manipulation, both in animal caps and whole embryos .

  • Immunoprecipitation and Western blotting: These biochemical techniques have been utilized to examine protein-protein interactions (e.g., RNF152's association with Dishevelled) and to analyze changes in protein levels (e.g., β-catenin, p-p70S6K) .

  • Immunohistochemistry: This approach has been used to visualize changes in protein expression and localization in tissue sections, particularly for analyzing cell proliferation markers (pHH3) and signaling pathway components (p-p70S6K, FoxA2) .

How can researchers effectively generate and validate RNF152 mutants for functional studies?

Creating and validating RNF152 mutants is crucial for dissecting its domain-specific functions:

  • Design of key mutants:

    • RNF152(CS): A point mutation in the RING domain (typically changing a critical cysteine to serine) to abolish E3 ligase activity while preserving protein structure .

    • RNF152(dTM): Deletion of the transmembrane domain to prevent lysosomal localization .

  • Cloning strategies:

    • Site-directed mutagenesis using PCR with internal primers for point mutations (CS mutant) .

    • PCR with modified primers to generate truncation mutants (dTM mutant) .

    • Cloning into expression vectors with appropriate tags (Flag, HA, Myc, GFP, RFP) for detection and functional assays .

  • Validation of mutants:

    • Protein expression: Western blotting to confirm expression levels and molecular weight .

    • Subcellular localization: Immunofluorescence or live cell imaging to verify localization patterns (lysosomal for wild-type and CS mutant, diffuse for dTM mutant) .

    • E3 ligase activity: Ubiquitination assays to confirm loss of catalytic activity in the CS mutant .

    • Functional validation: Comparative assays of wild-type and mutant effects on known pathways (Wnt/β-catenin, mTOR) .

  • Expression in Xenopus embryos:

    • mRNA synthesis: In vitro transcription of capped mRNAs for microinjection .

    • Dose calibration: Titration of mRNA amounts to avoid non-specific effects .

    • Rescue experiments: Co-injection with morpholinos to validate specificity .

For example, studies have shown that RNF152(CS) can inhibit Wnt signaling similarly to wild-type RNF152, while RNF152(dTM) cannot, demonstrating the importance of membrane localization but not E3 ligase activity for this function .

What methods are used to assess RNF152's impact on protein ubiquitination and degradation?

Several specialized techniques are employed to assess RNF152's ubiquitination activity:

  • In vivo ubiquitination assays:

    • Co-expression of RNF152 (wild-type or mutants), substrate proteins, and tagged ubiquitin in cells

    • Immunoprecipitation of substrate proteins followed by immunoblotting for ubiquitin to detect ubiquitination

    • Analysis of different ubiquitin linkage types (K48 vs. K63) using ubiquitin mutants

  • Protein stability analysis:

    • Cycloheximide chase assays to measure protein half-life in the presence or absence of RNF152

    • Proteasome inhibitor (e.g., MG132) treatment to determine if degradation is proteasome-dependent

    • Comparative analysis of wild-type vs. CS mutant effects on substrate levels

  • Autoubiquitination assays:

    • Assessment of RNF152 self-ubiquitination as a measure of intrinsic E3 ligase activity

    • Comparison of steady-state levels between wild-type and RNF152(CS) mutant

  • Substrate identification approaches:

    • Mass spectrometry-based identification of ubiquitinated proteins in RNF152-overexpressing cells

    • Screening approaches to identify specific E3 ligase-substrate relationships (as was done to identify RNF152 as an E3 ligase for RagA)

  • Functional readouts of pathway activity:

    • Monitoring downstream pathway components (e.g., p-p70S6K for mTOR signaling, β-catenin for Wnt signaling)

    • Analysis of reporter gene assays (e.g., Wnt-responsive promoter activity)

Research has shown that RNF152 mediates K63-linked polyubiquitination of RagA in response to amino acid starvation, which recruits GATOR1 and leads to RagA inactivation . Additionally, RNF152 has been shown to undergo autoubiquitination, which affects its own stability .

How do E3 ligase-dependent and -independent functions of RNF152 differ mechanistically?

RNF152 exhibits both E3 ligase-dependent and -independent functions, which operate through distinct mechanisms:

E3 ligase-dependent functions:

  • mTORC1 regulation: RNF152 ubiquitinates RagA (specifically the GDP-bound form), targeting it for degradation and thereby negatively regulating mTORC1 activity . This function requires both the RING finger domain (for catalytic activity) and the transmembrane domain (for lysosomal localization) .

  • Self-regulation: RNF152 undergoes autoubiquitination, which leads to its own degradation and a short half-life. This self-regulatory mechanism affects the kinetics of pathways regulated by RNF152 .

E3 ligase-independent functions:

  • Wnt/β-catenin inhibition: RNF152 inhibits Wnt/β-catenin signaling in an E3 ligase-independent manner, as demonstrated by the ability of the RNF152(CS) mutant to inhibit this pathway . This function still requires the transmembrane domain for proper localization.

  • Dishevelled regulation: RNF152 inhibits Dishevelled polymerization and puncta formation without ubiquitinating Dishevelled. Instead, it appears to physically interfere with Dishevelled self-association, disrupting signalosome formation .

  • Pro-apoptotic activity: While RNF152 has pro-apoptotic effects when overexpressed, both the CS and dTM mutants show reduced apoptotic activity, with the transmembrane domain being particularly important for this function .

The key distinguishing features between these mechanisms are:

  • Substrate specificity: E3 ligase-dependent functions involve specific substrate recognition and ubiquitination

  • Domain requirements: While both types of functions typically require the transmembrane domain, only E3 ligase-dependent functions require an intact RING domain

  • Protein interactions: E3 ligase-independent functions often involve physical associations or competitive binding rather than catalytic modification

Interestingly, the RNF152(CS) mutant sometimes shows stronger inhibitory effects on Wnt signaling than wild-type RNF152, likely because its inability to undergo autoubiquitination results in higher steady-state protein levels .

What is the molecular mechanism by which RNF152 inhibits Dishevelled polymerization?

RNF152 inhibits Dishevelled (Dsh) polymerization through a unique E3 ligase-independent mechanism:

  • Physical association: Co-immunoprecipitation experiments have demonstrated that RNF152 associates with Dishevelled in an E3 ligase-independent manner, as both wild-type RNF152 and the RNF152(CS) mutant can bind to Dsh .

  • Inhibition of Dsh self-association: RNF152 markedly reduces the association between differently tagged Dsh proteins (Myc-tagged and GFP-tagged) in a dose-dependent fashion, indicating that it interferes with Dsh oligomerization . RNF152(CS) exhibits an even stronger inhibitory effect on this interaction.

  • Disruption of Dsh puncta formation: In control animal cap cells, GFP-Dsh typically exhibits a punctate cytoplasmic pattern, reflecting Dsh polymerization. Co-expression of RNF152 disrupts this pattern, preventing the formation of Dsh puncta .

  • Consequences for signalosome assembly: Dsh polymerization normally provides a dynamic scaffold with a high concentration of binding sites for partners such as Frizzled receptors and Axin, forming the "signalosome" . This assembly is crucial for inhibiting GSK3-mediated phosphorylation of β-catenin and leading to β-catenin stabilization.

  • Mechanistic model: By preventing Dsh polymerization, high levels of RNF152 disrupt signalosome formation, thereby permitting GSK3 to phosphorylate β-catenin, which marks it for degradation. This explains how RNF152 negatively regulates Wnt/β-catenin signaling without directly ubiquitinating pathway components .

This mechanism represents a novel mode of regulating Wnt/β-catenin signaling and highlights how E3 ubiquitin ligases can have important functions beyond their catalytic activity. The precise structural basis for how RNF152 prevents Dsh self-association remains to be elucidated and presents an important area for future research .

How might RNF152's dual regulation of Wnt and mTOR pathways be integrated in development?

RNF152's ability to negatively regulate both Wnt/β-catenin and mTOR signaling pathways suggests a potential role as an integrator of these pathways during development:

  • Coordinated regulation of proliferation and differentiation:

    • mTOR pathway: RNF152 restricts cell proliferation by inhibiting mTOR signaling

    • Wnt pathway: RNF152 fine-tunes Wnt activity, which is crucial for cell fate determination and differentiation, particularly in neural crest cells

    • Together, these functions could coordinate the balance between proliferation and differentiation during development

  • Floor plate development as an integration point:

    • RNF152 is expressed in the floor plate, where it is regulated by FoxA2

    • Floor plate cells have low proliferation rates despite high Shh exposure

    • RNF152 may help maintain this state by inhibiting mTOR-driven proliferation while also modulating Wnt signaling for proper cell fate specification

  • Neural crest development:

    • Neural crest formation requires precise levels of Wnt signaling

    • RNF152 morphants show defects in craniofacial structures and pigmentation, indicative of neural crest abnormalities

    • The dual regulation of proliferation (via mTOR) and differentiation (via Wnt) by RNF152 may be particularly important for neural crest cells, which undergo extensive migration and differentiation

  • Potential crosstalk mechanisms:

    • Transcriptional regulation: Both pathways influence transcription factors that could regulate RNF152 expression, creating feedback loops

    • Protein stability: RNF152's autoubiquitination affects its own stability , potentially creating a node where signals from both pathways could converge to regulate RNF152 levels

    • Subcellular localization: RNF152's lysosomal localization positions it to sense and respond to nutrient status (through mTOR) while also affecting Wnt signaling components

  • Evolutionary perspective:

    • RNF152 function has been studied in multiple organisms (Xenopus, zebrafish, mouse)

    • Its role in regulating both fundamental pathways suggests an ancient and conserved function in coordinating growth and patterning

This integration of signaling pathways by RNF152 represents an important area for future research, particularly in understanding how developmental processes coordinate growth control with cell fate specification .

What are the most effective expression systems for producing recombinant Xenopus RNF152?

Producing functional recombinant Xenopus RNF152 requires careful consideration of expression systems:

  • Bacterial expression systems:

    • Advantages: High yield, low cost, simplicity

    • Challenges: RNF152 contains a transmembrane domain which may cause folding issues

    • Recommendations: Express soluble fragments (RING domain) separately; use fusion tags (MBP, SUMO) to enhance solubility; growth at lower temperatures (18-25°C)

    • Bacterial selection: Spectinomycin (100 μg/mL) can be used as a selection marker

  • Mammalian cell expression:

    • Advantages: Proper folding, post-translational modifications, membrane insertion

    • Systems: HEK293, MCF-7 cells show endogenous RNF152 expression and may provide appropriate processing machinery

    • Vectors: pCI-neo vectors with various tags (Flag, HA, Myc, GFP, RFP) have been successfully used

    • Considerations: RNF152 has pro-apoptotic activities when overexpressed , so inducible expression systems may be preferable

  • Cell-free systems:

    • Advantages: Rapid production, avoids toxicity issues

    • Applications: Useful for biochemical assays and structural studies of domains

    • Limitations: May not fully recapitulate membrane insertion

  • Xenopus oocyte/embryo expression:

    • Advantages: Native environment, relevant for developmental studies

    • Method: mRNA microinjection for transient expression

    • Applications: Useful for functional studies in the context of development

  • Purification considerations:

    • Full-length RNF152 is challenging to purify due to its transmembrane domain

    • Detergent solubilization (mild non-ionic detergents) can be used for membrane extraction

    • Domain-specific approaches may be more practical (express RING domain separately)

Based on the literature, mammalian expression systems appear most effective for producing full-length functional RNF152, while bacterial systems may be suitable for domain-specific studies .

How might understanding RNF152 function contribute to disease models or therapeutic approaches?

The multifaceted roles of RNF152 in key signaling pathways suggest several potential implications for disease models and therapeutic approaches:

  • Cancer biology and therapeutics:

    • mTOR pathway inhibition: RNF152 negatively regulates mTOR signaling, which is frequently hyperactivated in cancer . Understanding RNF152's mechanism could inspire novel mTOR-targeting strategies.

    • Wnt pathway modulation: Aberrant Wnt signaling is associated with various cancers . RNF152's ability to inhibit this pathway through Dishevelled regulation represents a novel mechanism that could be therapeutically exploited.

    • Expression correlation: KLHL22 (another E3 ligase) expression is significantly negatively correlated with DEPDC5 (a component of GATOR1, which interacts with RNF152-ubiquitinated RagA) in patients with breast cancer , suggesting potential clinical relevance.

  • Developmental disorders:

    • Neural crest-related conditions: RNF152 morphants exhibit defects in craniofacial structures and pigmentation , suggesting potential involvement in neurocristopathies.

    • Brain development: RNF152 plays a role in forebrain development , indicating possible relevance to neurodevelopmental disorders.

    • Growth disorders: Through its regulation of mTOR signaling, RNF152 might be involved in growth-related conditions.

  • Therapeutic targeting strategies:

    • E3 ligase modulators: Developing small molecules that modulate RNF152's E3 ligase activity could provide a way to regulate mTOR signaling.

    • Protein-protein interaction disruptors: Compounds targeting the interaction between RNF152 and Dishevelled could potentially modulate Wnt signaling.

    • Domain-specific approaches: Given RNF152's distinct functions through different domains, domain-specific targeting could allow pathway-selective intervention.

  • Model systems for drug discovery:

    • Xenopus embryos provide an excellent system for studying RNF152 function in development

    • Cell-based assays focusing on RNF152-dependent ubiquitination of RagA could be developed for screening compounds that modulate this activity

    • The observation that CB3A-induced inhibition of mTORC1 is sensitive in cells with endogenous RNF152 expression suggests RNF152 may be required for certain drug actions

While RNF152 knockout mice are viable (suggesting compensatory mechanisms) , conditional knockout approaches could reveal tissue-specific functions relevant to disease. Furthermore, the integration of RNF152 in both Wnt and mTOR pathways presents opportunities for developing therapeutics that simultaneously target multiple cancer-relevant pathways .

What are the key unanswered questions and future research directions for RNF152 studies?

Several critical questions remain unanswered about RNF152, presenting opportunities for future research:

  • Structural biology:

    • What is the crystal structure of RNF152, particularly its RING domain?

    • How does RNF152 physically interact with Dishevelled to prevent its polymerization?

    • What structural features determine substrate specificity for RNF152's E3 ligase activity?

  • Regulatory mechanisms:

    • How is RNF152 itself regulated at transcriptional, translational, and post-translational levels?

    • Besides FoxA2, what other transcription factors control RNF152 expression?

    • What proteins or signals regulate RNF152's E3 ligase activity?

  • Pathway integration:

    • How are RNF152's dual functions in Wnt and mTOR pathways coordinated?

    • Does RNF152 serve as a node for crosstalk between these pathways?

    • Are there additional signaling pathways regulated by RNF152?

  • Developmental roles:

    • What are the cell type-specific functions of RNF152 during development?

    • How is RNF152 involved in the timing of developmental processes?

    • What compensatory mechanisms explain the viability of RNF152 knockout mice?

  • Methodological advances needed:

    • Development of specific antibodies against Xenopus RNF152

    • Creation of conditional knockout models to study tissue-specific functions

    • High-resolution imaging of RNF152 dynamics during development

  • Clinical relevance:

    • Is RNF152 expression or function altered in specific diseases?

    • Could RNF152 be a biomarker for certain developmental disorders or cancers?

    • Are there natural variants of RNF152 associated with disease susceptibility?

  • Evolutionary perspectives:

    • How conserved are RNF152's functions across species?

    • Has RNF152 acquired new functions during vertebrate evolution?

    • How does RNF152 compare to other E3 ligases that regulate similar pathways?

  • Technical challenges:

    • Developing methods to study the full-length protein including the transmembrane domain

    • Creating tools to monitor RNF152 activity in real-time during development

    • Identifying all physiological substrates of RNF152

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.