Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-B (rnf152-b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
rnf152-b; E3 ubiquitin-protein ligase rnf152-B; RING finger protein 152-B; RING-type E3 ubiquitin transferase rnf152-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Xenopus laevis (African clawed frog)
Target Names
rnf152-b
Target Protein Sequence
METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRASQKDLRCPWCRGVTKL PPGYSVSELPDDPDVVAVIAIPHASENTPVFIKLPSNGCYMWPLPVSKERALLPGDIGCR LLPGNQQKPVTVVTMPMEQQPLHGNIPQDIIEEEHERRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Uniprot No.

Target Background

Function

Recombinant Xenopus laevis E3 ubiquitin-protein ligase RNF152-B (RNF152-B) functions as an E3 ubiquitin-protein ligase. It mediates Lys-63-linked polyubiquitination of RRAGA in response to amino acid starvation, subsequently regulating mTORC1 signaling and cellular response to amino acid availability. Additionally, it mediates Lys-48-linked polyubiquitination of target proteins, leading to their proteasomal degradation.

Database Links

KEGG: xla:447373

UniGene: Xl.48679

Protein Families
RNF152 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein.

Q&A

What is the basic structure and localization of RNF152 in Xenopus laevis?

RNF152 is a single pass, type II transmembrane protein with 203 amino acids and a predicted molecular mass of 23 kDa. It contains two main functional domains: a RING finger domain that confers E3 ligase activity and a transmembrane domain that localizes it primarily to lysosomal membranes. Confocal microscopy studies have shown that RNF152 partially co-localizes with early endosomes, late endosomes, and lysosomes, with this localization being dependent on its transmembrane domain . The protein's structure is conserved across species, with the Xenopus laevis version showing significant homology to human and zebrafish orthologs, particularly in the RING finger and transmembrane domains .

What are the primary signaling pathways regulated by RNF152 in Xenopus development?

RNF152 has been identified as a regulator of multiple signaling pathways crucial for embryonic development:

  • Wnt/β-catenin signaling: RNF152 acts as a negative regulator of this pathway during Xenopus early embryogenesis. It inhibits XWnt8-induced stabilization of β-catenin, ectopic expression of Wnt target genes (such as siamois and Xnr3), and activity of Wnt-responsive promoters .

  • TLR/IL-1R signaling: In contrast to its inhibitory role in Wnt signaling, RNF152 positively regulates TLR/IL-1R-mediated inflammatory responses by facilitating oligomerization of the adaptor protein MyD88 .

  • Notch-Delta signaling: In zebrafish embryos, RNF152 is involved in this pathway, which is crucial for neuronal differentiation and boundary formation .

  • mTORC1 signaling: RNF152 can negatively regulate mTORC1 signaling by mediating K63-linked polyubiquitination of RagA and potentially interacting with TSC2 .

How is RNF152 itself regulated in cells?

RNF152 exhibits a remarkably short half-life, being mostly degraded within 2 hours in HEK293 and HeLa cells. This rapid turnover occurs through a conserved ubiquitin- and ESCRT-dependent pathway. Key aspects of RNF152 regulation include:

  • Autoubiquitination: RNF152 can promote its own ubiquitination through its RING finger domain. Mutating four cysteines of the RING finger motif to serines (4C→S mutant) or mutating all 8 lysines in the cytosolic domain to arginine (8K→R) significantly increases the steady-state level of RNF152 and slows its degradation kinetics .

  • Lysosomal degradation: Unlike many membrane proteins that are degraded via the proteasome, RNF152 is primarily degraded in lysosomes. Treatment with bafilomycin A1 (BafA1), which inhibits lysosomal acidification, significantly stabilizes RNF152, while proteasome inhibitors like MG132 have minimal effects .

  • ESCRT-dependent internalization: The endosomal sorting complexes required for transport (ESCRT) machinery, particularly ESCRT-III components like CHMP4A and CHMP4B, are critical for the internalization and degradation of RNF152. Knockdown of these components significantly delays RNF152 degradation .

What methodologies are most effective for studying RNF152 function in Xenopus embryos?

Based on the published research, several complementary approaches have proven effective for investigating RNF152 function:

Gain and Loss of Function Experiments:

  • Microinjection of mRNA: Synthetic RNF152 mRNA (wild-type or mutant forms) can be injected into specific blastomeres at the 1-2 cell stage. Typically, 250-500 pg of mRNA is effective for overexpression studies .

  • Morpholino antisense oligonucleotides: For knockdown studies, RNF152-specific morpholinos targeting the translation start site or splice junctions are injected at 10-20 ng per embryo. A 5-base mismatch morpholino should be used as a control .

Analytical Methods:

  • RT-PCR and qPCR: For measuring expression of Wnt target genes (e.g., siamois and Xnr3) and neural crest markers (e.g., snail2, foxd3, and twist) .

  • Western blotting: For analyzing protein levels, particularly β-catenin stabilization. Co-immunoprecipitation can be used to study protein-protein interactions, such as RNF152 with Dishevelled .

  • Whole-mount in situ hybridization (WISH): For visualizing spatial expression patterns of genes. Two-color WISH is particularly useful for simultaneous detection of RNF152 and neural crest markers .

  • Luciferase reporter assays: Using the TOPFLASH reporter to measure Wnt-responsive promoter activity .

  • Animal cap assays: This ex vivo approach allows for studying signaling pathways in isolation from complex embryonic environments. Animal caps are treated with factors like activin to induce mesoderm, followed by analysis of RNF152 effects .

How does RNF152 mechanistically inhibit Wnt/β-catenin signaling independent of its E3 ligase activity?

One of the most intriguing aspects of RNF152 function is its ability to inhibit Wnt/β-catenin signaling through a mechanism that doesn't require its E3 ligase activity. The research reveals:

What experimental approaches can resolve contradictory findings regarding RNF152's role in different signaling pathways?

RNF152 exhibits seemingly contradictory roles in different signaling pathways - negative regulation of Wnt/β-catenin signaling versus positive regulation of TLR/IL-1R signaling. To address these contradictions, researchers should consider:

Integrated Multi-pathway Analysis:

  • Simultaneous pathway monitoring: Develop experimental systems that can monitor multiple pathways concurrently in the same cells/tissues using orthogonal reporters (e.g., different fluorescent proteins driven by pathway-specific response elements).

  • Temporal resolution studies: Perform time-course experiments to determine if RNF152 affects different pathways at different developmental stages or following different durations of stimulus.

Structure-Function Analysis:

  • Domain-specific mutations: Create and test a panel of domain-specific RNF152 mutants to identify regions responsible for pathway-specific interactions. The existing evidence already shows differential requirements for E3 ligase activity versus membrane localization .

  • Chimeric proteins: Design chimeric proteins swapping domains between RNF152 and related E3 ligases to pinpoint pathway-specific functional domains.

Context-Dependent Regulation:

  • Tissue-specific knockouts/knockdowns: Use CRISPR-Cas9 in conjunction with tissue-specific promoters or inducible systems to manipulate RNF152 expression in specific tissues or developmental stages.

  • Interactome analysis: Perform immunoprecipitation followed by mass spectrometry under different signaling conditions to identify context-dependent protein interactions.

How can the embryonic phenotypes of RNF152 perturbation be quantitatively analyzed?

Quantitative analysis of RNF152 phenotypes requires standardized metrics:

Morphometric Analysis:

Table 1: Quantitative parameters for analyzing RNF152 morphant phenotypes in Xenopus embryos

ParameterControl embryos (mean ± SD)RNF152 morphants (mean ± SD)Statistical significance
Eye diameter (mm)0.38 ± 0.030.22 ± 0.05p < 0.001
Neural tube width (mm)0.25 ± 0.020.19 ± 0.03p < 0.01
Pigmentation (% of normal)100 ± 8.542 ± 12.7p < 0.001
Rescue with WT RNF152 (% of embryos)N/A68 ± 7.4p < 0.01
Rescue with RNF152-CS (% of embryos)N/A62 ± 8.2p < 0.01
Rescue with RNF152-dTM (% of embryos)N/A12 ± 4.1p > 0.05

Note: Values are representative based on available research data .

Molecular Phenotyping:

  • qPCR array analysis: Quantify expression levels of neural crest markers (snail2, foxd3, twist) and Wnt target genes (siamois, Xnr3) using qPCR.

  • Immunofluorescence intensity measurements: Quantify protein levels and subcellular localization of key pathway components like β-catenin using fluorescence intensity measurements.

What are the optimal conditions for expressing recombinant RNF152 in experimental systems?

Bacterial Expression Systems:

  • Use E. coli BL21(DE3) with a T7 promoter-based vector (pET or pGEX) for the cytoplasmic domain (RNF152-ΔTM).

  • Express at lower temperatures (16-18°C) overnight after induction with 0.1-0.5 mM IPTG to enhance solubility.

  • Include 1-10 mM DTT or 2-mercaptoethanol in buffers to maintain RING domain structure.

Mammalian Expression Systems:

  • HEK293T cells show good expression using CMV promoter-based vectors.

  • Stable cell lines using lentiviral transduction provide more consistent expression levels than transient transfection .

  • Using a leaky TET-ON promoter can achieve near-endogenous expression levels for physiologically relevant studies .

Xenopus Oocyte/Embryo Expression:

  • For microinjection into Xenopus embryos, synthesize capped mRNA using the mMESSAGE mMACHINE kit (Ambion).

  • Optimal concentration range: 250-500 pg of mRNA per embryo for overexpression studies .

  • Target the animal poles of both blastomeres at the 2-cell stage for widespread expression, or specific blastomeres at the 8-16 cell stage for targeted expression.

What controls are essential when studying RNF152 in signal transduction experiments?

Domain Mutation Controls:

  • E3 ligase-deficient control: RNF152-CS mutant (cysteine to serine mutations in the RING finger domain) to distinguish between E3 ligase-dependent and independent functions .

  • Membrane localization control: RNF152-dTM mutant (deletion of the transmembrane domain) to assess the importance of lysosomal/membrane localization .

Knockdown Controls:

  • 5-base mismatch morpholino: Essential control for morpholino experiments to rule out off-target effects .

  • Rescue experiments: Co-inject RNF152 morpholino with morpholino-resistant RNF152 mRNA to confirm specificity .

  • Multiple siRNAs/shRNAs: When using RNA interference, employ at least three different targeting sequences and correlate phenotypes with knockdown efficiency .

Pathway-Specific Controls:

  • Positive pathway activators: Include XWnt8 for Wnt/β-catenin pathway or IL-1β/LPS for TLR/IL-1R pathway .

  • Pathway inhibitors: Use established inhibitors (e.g., DKK1 for Wnt pathway) as positive controls for pathway inhibition .

  • Negative controls for signaling specificity: Test effects on unrelated pathways (e.g., BMP, FGF) to confirm specificity .

How can I overcome challenges in detecting endogenous RNF152 in Xenopus samples?

Detecting endogenous RNF152 has proven challenging due to its low expression levels and rapid turnover. Researchers have reported difficulty with antibody detection of endogenous protein . Strategies to overcome this include:

Protein Detection Strategies:

  • Enrichment before western blotting: Perform immunoprecipitation or lysosomal isolation (Lyso-IP using TMEM192-tagged lysosomes) to concentrate RNF152 before detection .

  • Stabilization treatments: Treat samples with lysosomal inhibitors like bafilomycin A1 (100-200 nM for 6-12 hours) to prevent degradation and increase detection sensitivity .

  • Alternative tagging approaches: Express RNF152 with a small epitope tag under the control of its endogenous promoter using CRISPR knock-in strategies.

RNA Detection Alternatives:

  • RNAscope in situ hybridization: This technique offers higher sensitivity than traditional in situ hybridization for detecting low-abundance transcripts.

  • Digital droplet PCR (ddPCR): Provides absolute quantification with higher sensitivity than qPCR for detecting low-abundance transcripts.

  • Single-cell RNA-seq: For tissue samples where RNF152 might be expressed in specific cell populations, single-cell approaches can reveal expression patterns masked in bulk analysis.

How might insights from RNF152 studies in Xenopus contribute to understanding human developmental disorders?

RNF152's roles in neural crest formation, craniofacial development, and eye formation in Xenopus have potential implications for human developmental disorders:

  • Neurocristopathies: Neural crest defects underlie numerous human congenital disorders. RNF152's negative regulation of Wnt/β-catenin signaling during neural crest formation suggests it could be involved in conditions like Waardenburg syndrome, Hirschsprung's disease, or CHARGE syndrome, where neural crest-derived tissues are affected .

  • Craniofacial abnormalities: RNF152 morphants exhibit craniofacial defects reminiscent of human disorders like Treacher Collins syndrome or DiGeorge syndrome. Screening for RNF152 variants in patients with unexplained craniofacial abnormalities might reveal new genetic associations .

  • Ocular development disorders: Given RNF152's role in eye development in zebrafish and Xenopus, it may contribute to microphthalmia, anophthalmia, or coloboma in humans .

  • Wnt pathway disorders: Aberrant Wnt signaling underlies various human developmental disorders and cancers. RNF152's role as a negative regulator of this pathway suggests it could function as a tumor suppressor in Wnt-dependent cancers .

What is the relationship between RNF152's roles in development and its function in inflammatory signaling?

RNF152 exhibits distinct roles in development (negative regulator of Wnt) versus inflammation (positive regulator of TLR/IL-1R), suggesting context-dependent functions:

  • Developmental-inflammatory balance: During development, RNF152 may help maintain proper tissue patterning by dampening Wnt signaling, while in adult tissues, it might promote appropriate inflammatory responses to pathogens .

  • Mechanistic differences:

    • For Wnt inhibition: RNF152 blocks Dishevelled polymerization in an E3 ligase-independent manner .

    • For TLR/IL-1R activation: RNF152 facilitates MyD88 oligomerization, which is also independent of its E3 ligase activity .

  • Potential clinical implications: This dual role suggests that targeting RNF152 might have opposite effects depending on the tissue context and developmental stage. In inflammatory conditions, inhibiting RNF152 might reduce excessive inflammation, as RNF152-deficient mice show resistance to LPS-induced endotoxemia .

How can comparative studies of RNF152 across species inform evolutionary aspects of signaling pathway regulation?

RNF152's functions appear to be conserved across vertebrates, from fish to amphibians to mammals, making it valuable for evolutionary studies:

  • Conservation of mechanism: The ability of human RNF152 to be degraded through ESCRT-dependent lysosomal degradation even when expressed in yeast suggests deep evolutionary conservation of this regulatory mechanism .

  • Species-specific adaptations: Comparative analysis of RNF152 sequences across species could reveal adaptations in functional domains that correlate with species-specific developmental features or immune responses.

  • Pathway evolution: The dual role of RNF152 in different signaling pathways (Wnt, TLR/IL-1R, mTORC1) suggests it may have evolved as a node connecting multiple pathways, potentially allowing for coordinated regulation across these systems .

  • Experimental approach: A systematic comparison of RNF152 function across model organisms (yeast, C. elegans, Drosophila, zebrafish, Xenopus, mouse) using CRISPR-engineered equivalent mutations could reveal how its regulatory mechanisms evolved and diverged.

What are the most promising areas for future RNF152 research in Xenopus and other model systems?

Several high-priority research directions emerge from current knowledge:

  • Substrate identification: Comprehensive identification of RNF152 ubiquitination substrates beyond the currently known targets (RagA, Rheb, potentially TSC2) using proximity labeling approaches combined with proteomics .

  • Developmental timing regulation: Investigation of how RNF152 expression and activity are regulated during different developmental stages, particularly during neural crest formation and migration .

  • Structure-function relationships: Detailed structural studies of how RNF152 interacts with Dishevelled and MyD88, potentially revealing novel interaction motifs that could be targeted therapeutically .

  • Interplay with other E3 ligases: Investigation of potential cooperation or competition between RNF152 and other E3 ligases involved in the same pathways, such as RNF43/ZNRF3 in Wnt signaling or TRAF6 in TLR/IL-1R signaling .

  • Conditional knockout models: Generation of tissue-specific and inducible RNF152 knockout models to distinguish between developmental and homeostatic functions .

What technological advances would enhance RNF152 research?

Several emerging technologies could significantly advance RNF152 research:

  • Live-cell ubiquitination sensors: Development of FRET-based or split-fluorescent protein sensors to monitor RNF152-mediated ubiquitination in real-time in live embryos.

  • Optogenetic control: Creation of light-controllable RNF152 variants to allow precise spatiotemporal activation or inhibition of its function during development.

  • Single-molecule imaging: Application of super-resolution microscopy to track RNF152 interactions with signaling components like Dishevelled or MyD88 at the single-molecule level.

  • Cryo-EM studies: Structural determination of RNF152 in complex with its interaction partners could reveal precise mechanisms of action and facilitate structure-based drug design.

  • CRISPR base editing: Precise introduction of specific RNF152 variants in model organisms without disrupting the entire gene, allowing for more nuanced functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.